Advertisement

  • Loading metrics

Open Access

Correction

Correction: PP2A/B55 and Fcp1 Regulate Greatwall and Ensa Dephosphorylation during Mitotic Exit

  • The PLOS Genetics Staff

There is a mistake in the alignment of the Drosophila Greatwall sequence in Figure 2A.

The correct Drosophila sequence is: fglskidmrrdleisdlincspnlnartpgqllsltshlsfgsekklndfgsvssgqnngmg

This sequence does not contain a conserved TTP Cdk consensus site at the residues equivalent to the human Threonine 193 and 194.

Note that there is a TP in this sequence, which could be a relevant Cdk phosphorylation site.

This requires further experimental evidence.

Reference

  1. 1. Hégarat N, Vesely C, Vinod PK, Ocasio C, Peter N, et al. (2014) PP2A/B55 and Fcp1 Regulate Greatwall and Ensa Dephosphorylation during Mitotic Exit. PLoS Genet 10(1): e1004004

Citation: The PLOS Genetics Staff (2014) Correction: PP2A/B55 and Fcp1 Regulate Greatwall and Ensa Dephosphorylation during Mitotic Exit. PLoS Genet 10(2): e1004259. https://doi.org/10.1371/journal.pgen.1004259

Published: February 27, 2014

Copyright: © 2014 The PLOS Genetics Staff. This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited.