Skip to main content
Advertisement
Browse Subject Areas
?

Click through the PLOS taxonomy to find articles in your field.

For more information about PLOS Subject Areas, click here.

  • Loading metrics

New highly antigenic linear B cell epitope peptides from PvAMA-1 as potential vaccine candidates

  • Raianna F. Fantin,

    Roles Data curation, Formal analysis, Methodology, Writing – original draft

    Affiliations Department of Parasitology, Federal University of Minas Gerais, Belo Horizonte, Minas Gerais, Brazil, School of Medicine, Federal University of Minas Gerais, Belo Horizonte, Brazil

  • Vanessa G. Fraga,

    Roles Data curation, Formal analysis, Methodology

    Affiliation Department of Parasitology, Federal University of Minas Gerais, Belo Horizonte, Minas Gerais, Brazil

  • Camila A. Lopes,

    Roles Data curation, Formal analysis, Methodology

    Affiliation Department of Parasitology, Federal University of Minas Gerais, Belo Horizonte, Minas Gerais, Brazil

  • Isabella C. de Azevedo,

    Roles Data curation, Methodology, Resources

    Affiliation Department of Parasitology, Federal University of Minas Gerais, Belo Horizonte, Minas Gerais, Brazil

  • João L. Reis-Cunha,

    Roles Data curation, Formal analysis, Writing – review & editing

    Affiliation Department of Preventive Veterinary, Medicine Federal University of Minas Gerais, Belo Horizonte, Brazil

  • Dhelio B. Pereira,

    Roles Conceptualization, Formal analysis, Investigation, Methodology

    Affiliation Tropical Medicine Research Center, Porto Velho, Rondônia, Brazil

  • Francisco P. Lobo,

    Roles Conceptualization, Data curation, Software

    Affiliation Department of Parasitology, Federal University of Minas Gerais, Belo Horizonte, Minas Gerais, Brazil

  • Marcela M. de Oliveira,

    Roles Data curation, Formal analysis, Methodology, Validation

    Affiliation Tropical Medicine Research Center, Porto Velho, Rondônia, Brazil

  • Anderson C. dos Santos,

    Roles Data curation, Formal analysis, Methodology, Software

    Affiliation Department of Parasitology, Federal University of Minas Gerais, Belo Horizonte, Minas Gerais, Brazil

  • Daniela C. Bartholomeu,

    Roles Conceptualization, Data curation, Formal analysis, Funding acquisition, Methodology

    Affiliation Department of Parasitology, Federal University of Minas Gerais, Belo Horizonte, Minas Gerais, Brazil

  • Ricardo T. Fujiwara,

    Roles Conceptualization, Data curation, Formal analysis, Funding acquisition, Methodology, Project administration, Validation, Writing – original draft

    Affiliation Department of Parasitology, Federal University of Minas Gerais, Belo Horizonte, Minas Gerais, Brazil

  • Lilian L. Bueno

    Roles Conceptualization, Data curation, Formal analysis, Funding acquisition, Investigation, Methodology, Project administration, Resources, Supervision, Validation, Writing – original draft

    llbueno@icb.ufmg.br

    Affiliation Department of Parasitology, Federal University of Minas Gerais, Belo Horizonte, Minas Gerais, Brazil

Abstract

Peptide-based vaccines have demonstrated to be an important way to induce long-lived immune responses and, therefore, a promising strategy in the rational of vaccine development. As to malaria, among the classic vaccine targets, the Apical membrane antigen (AMA-1) was proven to have important B cell epitopes that can induce specific immune response and, hence, became key players for a vaccine approach. The peptides selection was carried out using a bioinformatic approach based on Hidden Markov Models profiles of known antigens and propensity scale methods based on hydrophilicity and secondary structure prediction. The antigenicity of the selected B-cell peptides was assessed by multiple serological assays using sera from acute P.vivax infected subjects. The synthetic peptides were recognized by 45.5%, 48.7% and 32.2% of infected subjects for peptides I, II and III respectively. Moreover, when synthetized together (tripeptide), the reactivity increases up to 62%, which is comparable to the reactivity found against the whole protein PvAMA-1 (57%). Furthermore, IgG reactivity against the tripeptide after depletion was reduced by 42%, indicating that these epitopes may be responsible for a considerable part of the protein immunogenicity. These results represent an excellent perspective regarding future chimeric vaccine constructions that may come to contemplate several targets with the potential to generate the robust and protective immune response that a vivax malaria vaccine needs to succeed.

Introduction

Malaria disease represents a huge challenge for public authorities in Brazil and in the worldwide. Of the species that infect humans, Plasmodium vivax and Plasmodium falciparum are considered to be the most important from a public health point of view. While deaths and several cases are mostly reported coming from P. falciparum infection, P. vivax is responsible for causing 90% of cases registered outside Africa. In 2019, an estimated 229 million cases of malaria occurred worldwide [1]. Specifically in Brazil, 194,000 cases were reported in the same period and P. vivax stands out being responsible for around 80% of those [2]. This species is particularly challenging for malaria control not only because of its wider global distribution but also because of its high frequency of sub-microscopic infections, and ability to produce relapses from long-lasting liver-stages infections [3, 4].

In the last decades, efforts have been made to develop vaccines against different stages of P. vivax. Among the classic targets, the Apical membrane antigen (AMA-1), a transmembrane protein located in the micronemes of the parasite and present in all species of Plasmodium, is a promising target to induce a protective immune response as demonstrated in rodent and non-human primates’ experimental models [5]. Among its functional aspects, the mediation of parasite internalization within the host cell through a structure formed by AMA-1 and the erythrocyte complex of proteins named Rhoptry Neck (RON), is one of the most remarkable [68]. There is strong evidence that antibodies and peptides against the junction formed by these two molecules can inhibit the invasion of parasites in the erythrocytes of human hosts [5, 9]. Furthermore, specifically regarding P. vivax AMA-1 (PvAMA-1), immuno-epidemiological studies conducted in different endemic regions of Brazil, India and Sri-Lanka have demonstrated a naturally acquired immune response to this protein even in individuals with limited exposure to the disease [10, 11]. Of note, a linear epitope derived from the domain II of PvAMA-1 was identified through bioinformatic analysis and synthetic production [7] and the favorable data support for the development of a PvAMA-1-based subunit vaccine against malaria vivax infection. Indeed, the identification of highly immunogenic peptides through bioinformatic tools is one of the most promising [12, 13]. Developing peptide-based antigens may have numerous advantages. Amidst them, the most important ones navigate through cost, stability, easy reproducibility, capacity in result specific immune response and the possibility to generate chimeras containing multiple epitopes that might be relevant [14]. Moreover, antigens that are peptide-based have demonstrated to be able to induce long-lived immune responses since they can be customized to aim very specific targets [15].

In this context, the identification of immunodominant targets that allows the development of vaccines against P. vivax may be critical in the success of a research agenda to underpin malaria control and elimination. Here we present three new highly antigenic linear B cell epitope peptides within the PvAMA-1 as potential vaccine candidates. They have showed to be strong candidates when assessed individually or as a multi-component antigen, with an immunogenicity that is equivalent to the entire PvAMA-1 protein.

Methods

Study population, sera samples and ethical statements

The study population included 121 individuals living in the Brazilian Amazon area who were diagnosed with vivax malaria at the Research Center for Tropical Medicine (CEPEM) in Porto Velho, Rondônia, Brazil, in the years of 2014 (Jul) and 2019 (Nov–Dec). The volunteer’s inclusion criteria in this study group was (i) to have an acute infection at the moment of blood sampling; (ii) be over 18 years of age and (iii) to be willing to participate in the study. Considering that the subjects participating in the study were chosen as they sought the city’s health service, the selection was random, in a way that allowed each member of the larger group—the population of Porto Velho—to have an equal chance of being chosen. Although certain characteristics such as occupation and place of residence have been shown to be of importance in the rate of infection in other studies [1618], since certain environments can lead to greater exposure to the vector (farmers, rural households, etc.), in this study no relationship was observed between occupation/residence and malaria incidence. Fifteen healthy individuals from Belo Horizonte, Minas Gerais State, Brazil, a non-endemic area for malaria, were also recruited as controls. Each volunteer was required to sign a written informed consent specific to this study, and blood was obtained upon receiving the said document. The research was approved by the Research Ethics Council of the Federal University of Minas Gerais, Brazil (CAAE 27466214.0.0000.5149).

Peptide selection

The prediction of B cell linear epitopes was carried out using the program BepiPred 1.0 as described before [10]. Briefly, the software takes a single sequence in FASTA format as input, and each amino acid receives a prediction score based on Hidden Markov Models profiles of known antigens and incorporates propensity scale methods based on hydrophilicity and secondary structure prediction. The lowest cut-off of 0.35 was used in order to consider a given region as a valid linear B cell epitope. The epitope score represents the average of the scores of individual amino acids above the cut-off.

Peptide conservation evaluation.

To evaluate the conservation of the selected peptides, a total of 218 PvAMA-1 sequences were recovered from PlasmoDB [19]. Out of those, only sequences with a read depth coverage higher than 30 and with at least 90% of its reads mapping to the reference were selected, using the metadata provided by PlasmoDB. Next, sequences that had 10 or more “N”s were removed, using in-house Perl scripts, resulting in a final selection of 64 sequences for downstream analysis. These 64 sequences were aligned using MAFFT v7.427 [20], with—maxiterate 1000—globalpair—adjustdirection–reorder options. The aligned sequences were then translated with SeqKit translate v.0.12.0 [21], and the conservation estimation, plots, tables, and logo images were generated in R (https://www.R-project.org/), using the following libraries: seqinr [22], ggplot2, and ggseqlogo [23].

Synthesis and mass spectrometry of soluble peptides

The soluble peptides EEFRDYYENGEEKSNKQM (PI), SSGVRVDLGEDAEVENAK (PII), GDQRLKDGGFAFPNADDH (PIII) and KLKDGGFAFPNANDHEEFRDYYENGEEKSNKQM (tripeptide) were synthesized on a 25 μmol scale in the ResPep SL automated synthesizer (Intavis®). Brielfy, Fmoc-amino acids were activated with a 1∶1 solution of Oxyma Pure (Merk) and diisopropylcarbodiimide (DIC, Sigma-Aldrich). The active amino acids were incorporated into TentaGel (Intavis) (Peptides I and II) or H-Rink Amide ChemMatrix (Sigma-Aldrich) (Peptide III and Tripeptide) resins. Fmoc deprotection was performed using 25% 4-methylpiperidine (25% v/v in DMF). These steps were repeated until the synthesis of each peptide was completed. The peptides were deprotected and released form the resin by treatment with a solution of 92.5% trifluoroacetic acid, 2.5% water, 2.5% triisopropylsilane and 2.5% beta-mercaptoethanol during 3 hours under agitation. Specifically, for the Tripeptide the synthesis was performed using a chaotropic agent and lithium chloride (0.8M). The time of deprotection was prolonged in order to guarantee the proper extension of the polypeptide chain. The peptides were precipitated with cold methyl tert-butyl ether and lyophilized. The molecular weight of each peptide synthetized was confirmed by mass spectrometry using Autoflex Speed MALDI/TOF equipment.

Mass spectrometry (MALDI/TOF)

For the analysis, 0.5 μL of the concentrated sample was mixed with 0.25 mL of a saturated matrix solution 10 mg/mL α-cyano-4-hydroxycinnamic (Aldrich, Milwaukee, WI) in 50% acetonitrile/0.1% trifluoroacetic acid. The samples were applied to a MTP AnchorChip ™ 600/384 plate (Bruker Daltonics) and left to dry at room temperature. The raw data was obtained by MALDI-TOF/TOF Autoflex III™ (Bruker Daltonics, Billerica, USA) using a positive/reflector mode controlled by FlexControl™ 3.3 software. The instrument calibration was performed using reference peptides (Peptide Standard, Bruker Daltonics). Each spectrum was produced by accumulating data from 200 consecutive laser shots.

Expression and purification of the Apical membrane Protein 1 (PvAMA-1/Sal-1)

The protein representing amino acids 1 to 546 of AMA-1 was expressed in Escherichia coli, as previously described [10, 24]. Briefly, the recombinant plasmid containing pUC57/AMA-1 synthetic gene (GenScript) was resuspended and transformed with competent cells from Escherichia coli XL-1 Blue (Phoneutria, Brazil). After positive clones were confirmed by digestion with the enzymes XhoI and NheI, the AMA-1 insert was subcloned into a bacterial expression vector pET28aTEV. Electrocompetent E. coli BL21-Star (Thermo Fisher Scientific, USA) cells were transformed with the recombinant plasmid pET28a-TEV/AMA-1 by electroporation using a MicroPulser Electroporation Apparatus (Bio-Rad Laboratories, USA). Correct gene insertion was confirmed by colony PCR and using T7 primers (Macrogen, South Korea). Protein large scale expression was obtained after the addition of 1mM isopropyl β-D-1-thiogalactopyranoside (IPTG) and incubation for 3 h at 37°C at 180rpm. Cells were ruptured by a high-pressure homogenizer and soluble fractions were obtained by centrifugation. The recombinant protein was purified using Ni2+ affinity chromatography with HisTrap HP 5 mL column (GE Healthcare, USA) coupled to an ÄKTA Prime Plus system (GE Healthcare, USA). The purified AMA-1 protein, having 546 amino acids and predicted molecular weight of 62kDa, was separated by SDS-PAGE.

Serological assays

Total IgG.

The presence of IgG antibodies against PvAMA-1 protein and all four peptides were determined through a conventional enzyme-linked immunosorbent assay (ELISA) that was performed as previously described [10, 25]. Briefly, the microplates (Costar®) were coated with the antigens (concentrations of 0.5μg/mL and 2μg/well for PvAMA-1 and peptides respectively) and incubated overnight at 4°C for PvAMA-1 and at 37°C for peptides. Subsequently, the plates were washed and blocked (PBS 1x pH 7.2 + 3% BSA). All samples were diluted 1:100 and evaluated for total IgG using peroxidase-conjugated anti-human IgG antibodies at a concentration of 1:10.000 (Catalog No. W4031) (Promega Corporation). Monoclonal antibody binding was detected with OPD substrate tablets (Thermo Fisher Scientific, USA). The cut-off value was obtained by testing 15 different negative control sera from individuals never exposed to malaria from Belo Horizonte, Brazil. The mean optical density value at 492 nm ± 3 SD (VersaMaxTM Microplate Reader) for duplicate determinations in negative sera was used as the cut-off value for different peptides.

IgG subclasses.

The ELISA to detect the IgG subclasses was performed as previously described [10]. The sera were diluted 1:100 and evaluated for each IgG subclass using mouse monoclonal antibodies to human IgG subclasses (IgG1 clone 8c/6-39; IgG2 clone HP-6014; IgG3 clone HP-6050; IgG4 clone HP-6025) (Sigma, St. Louis, MO) according to the manufacturer instructions. Specifically, the secondary antibody dilutions were 1:1.000, 1:15.000, 1:40.000 and 1:60.000 for IgG 1, IgG 2, IgG 3 and IgG 4 respectively. The cut-off value was obtained by testing 6 different negative control sera from individuals never exposed to malaria from Belo Horizonte, Brazil. Monoclonal antibody binding was detected with OPD substrate tablets (Thermo Fisher Scientific, USA). The mean optical density value at 492 nm±3 SD (VersaMaxTM Microplate Reader) for duplicate determinations in negative sera was used as the cut-off value for different subclasses and peptides.

Depletion ELISA

The depletion ELISAs were performed as previously described [26]. Briefly, flat-bottom plates (Costar, USA) were coated overnight with 2 μg/well of the peptides EEFRDYYENGEEKSNKQM (PI), SSGVRVDLGEDAEVENAK (PII), GDQRLKDGGFAFPNADDH (PIII) and SSGVRVDLGEDAEVENAKGDQKLKDGGFAFPNANDHEEFRDYYENGEEKSNKQM (tripeptide), then washed and blocked as described. Sera were added to the plates at a 1:100 dilution and incubated at 37°C overnight. On the following day, sera were transferred to plates coated overnight with PvAMA-1 (0,5 ug/mL) after appropriate washing and blocking.

Statistical analysis

All statistics were carried out using Graphpad Prism 8 for iOS (Graphpad Software, Inc.). In order to determine whether a variable was normally distributed, we used Shapiro-Wilk and Kolmogorov-Sminorff tests. The frequency and association between IgG antibody response (total and subclasses) to PvAMA-1 and all four peptides was determined by Fisher’s exact test. P values for the depletion ELISA were determined by Wilcoxon matched pairs test. All p values <0.05 were considered significant.

Results

Epidemiological profile of studied individuals

The study population is composed of 121 individuals residing in the city of Porto Velho (Rondônia) and neighboring municipalities (Table 1). The majority is composed of adult individuals naturally exposed to the malaria parasite and the age range was 29–- 49 with an average of 39 years old. The gender ratio was 1:3 (female: 23.9%; male: 76.1%). Regarding previous malaria infections, the majority of them have had both most prevalent species currently circulating in Brazil: P. falciparum and P. vivax (44.6%), following by those who have only been infected with P. vivax (37.2%); with none of them (15.7%) and finally, only with P. falciparum (1.65%). In general, the parameters, that might differ depending on gender and occupation, indicate that individuals are frequently exposed to malaria. The control population was comprised of 15 non-exposed and never infected individuals living in a non-endemic area. These individuals had an age range of 26.5–33, with an average of 28 years. The gender ratio was (female: 61.53% male: 38.46%) (Table 2).

thumbnail
Table 1. Epidemiological and demographic characterization of infected subjects from endemic area (2014/2019), n = 121.

https://doi.org/10.1371/journal.pone.0258637.t001

thumbnail
Table 2. Epidemiological and demographic characterization of non-infected subjects/controls from non-endemic area (2019), n = 15.

https://doi.org/10.1371/journal.pone.0258637.t002

Prediction results, chemical synthesis, and quality assessment of selected peptides

The predicted peptides were found to be distributed within two of the three PvAMA-1 domains, being PI part of domain III, and P II and III part of domain I. An analysis conducted using PlasmoDB sequences confirmed that the peptides are well conserved (Fig 1), with little or no variation in amino acids positions (S1 Fig, S1 Table), especially PI, which demonstrated to be 100% conserved in all assessed isolates. The molecular weights (MW) of each specie were accessed in PepCalc.com–- Peptide calculator (InnovagenTM) namely: PI (2295.4 g/mol), PII (1873.97 g/mol), PIII (1930.04 g/mol) and Tripeptide (6065.35 g/mol). All MW were experimentally confirmed through characterization of the synthetic peptides by MALDI-TOF-TOF (S2 Fig). It is possible to observe the isotopic envelope of the small molecules (PI, PII and PIII) in the graphs (S2A–S2C Fig respectively), since it was able to use the reflector mode in their characterization. It wasn’t possible to observe the isotopic envelope of the largest species–tripeptide–whereas the linear mode with lower resolution was used in the characterization, considering the reduced ionization capacity of this molecule. The tridimensional structure of each peptide was predicted using two different software: i-TASSER for smaller peptides (Fig 2A–2C) and RaptorX for the bigger one, as shown in Fig 2D [2731]. We observed that PI and PII exhibits some regions in α-helix despite their small sizes and their secondary structures are partially preserved in the Tripeptide.

thumbnail
Fig 1. Logo representation of the amino acid conservation of the selected peptides in 64 P. vivax isolates from PlasmoDB.

The frequency of each amino acid in each position is represented by the size of its corresponding letter. Each colour corresponds to a physicochemical property.

https://doi.org/10.1371/journal.pone.0258637.g001

thumbnail
Fig 2. Predicted secondary structure of the synthetic peptides.

(A) Peptide I (EEFRDYYENGEEKSNKQM): helix and coil dominance. (B) Peptide II (SSGVRVDLGEDAEVENAK): Strand and coil dominance. (C) Peptide III (GDQRLKDGGFAFPNADDH): coil dominance. (D) Tripeptide (SSGVRVDLGEDAEVENAKGDQKLKDGGFAFPNANDHEEFRDYYENGEEKSNKQM): helix and beta dominance.

https://doi.org/10.1371/journal.pone.0258637.g002

Evaluation of total IgG response to selected antigens

In the current study, the presence of total IgG antibody response from naturally P. vivax-infected individuals was assessed in face of the selected peptides (18 and 54 amino acids) and the whole PvAMA-1 (560 amino acids) in order to compare the immunogenic capacity of each of them. For this purpose, samples from 121 individuals with acute infection by P.vivax were evaluated by conventional serology (ELISA). Regarding the frequency of individuals responding to the tested peptides and proteins, we observed a 57% positivity for PvAMA-1 (69/121), 62% for the tripeptide (76/121) and 45.5% (55/121), 48.7% (59/121), 32.2% (39/121) for peptides I, II and III respectively. When compared to peptides I, II, III, the PvAMA-1 (Fig 3A) presents a higher and statistically significant frequency only when compared to peptide III (p = <0.0002 Fisher’s exact test). Regarding peptides I and II, there is no significant difference between the frequency of responses, which suggests that those peptides alone can be recognized as much as the whole protein PvAMA-1 (PI p = 0.09; PII p = 0.24, Fisher’s exact test). The same cannot be observed when we compare the frequency of response of the tripeptide (54aa) to the smaller ones. The tripeptide, which represents the chemical junction of peptides I, II and III, shows a higher frequency of positivity in all comparisons (PI p = 0.009; PII p = 0.038; PIII p = <0.0001, Fisher’s exact test) (Fig 3B). Of relevance, although no significant differences were observed between the immunogenic capacity of PvAMA-1 and the tripeptide (p = 0.43%, Fisher’s exact test), the frequency of respondents was different between these two antigens (Fig 3C). More specifically, the percentage of individuals with specific antibodies to the tripeptide was slightly higher than against the whole protein (+ 5%).

thumbnail
Fig 3. Levels of specific IgG antibodies to PvAMA-1, Peptide I (PI), Peptide II (PII), Peptide III (PIII) and tripeptide.

(A) Comparison of the IgG levels between PvAMA-1 and the 18aa peptides. (B) Comparison of the IgG levels between tripeptide and the 18aa peptides. (C) Comparison between PvAMA-1 and tripeptide. The Y axis represents the mean reactivity index in naturally P. vivax infected individuals (= 121). The dotted line shows the positivity threshold (reactivity index = 1). The data were analyzed considering a 95% confidence interval (CI). P < 0.05 was considered significant.

https://doi.org/10.1371/journal.pone.0258637.g003

Similar IgG subclass response pattern between tested peptides

Although this type of data may considerably vary among individuals naturally infected with Plasmodium vivax, the level of specific antibodies for each IgG subclass followed a pattern as for peptides composed of only 18 amino acids (PI, PII, PIII). For them, there was a higher frequency of IgG2 (PI: 61.6% PII: 28.30% PIII: 35%) and IgG3 (PI: 66%; PII: 61.6%; PIII: 65.8%) (Fig 4A–4C). When compared to PvAMA-1, there was a statistically significant difference for the following subclasses: IgG 2 (PI p = <0.0001; PII p = 0.01; PIII p = 0.0003, Fisher’s exact test); IgG 3 (PI, PII and PIII p = <0.0001, Fisher’s exact test); IgG 4 (PI p = 0.001, Fisher’s exact test). As for the tripeptide and PvAMA-1, subclass 1 had more frequent and robust recognition (Fig 4D and 4E).

thumbnail
Fig 4. Proportion of IgG subclasses antibodies to the synthetic peptides and PvAMA-1.

(A) Peptide I; (B) Peptide II; (C) Peptide III; (D) Tripeptide; (E) PvAMA-1; (F) Peptides and Pv-AMA-1 merged together. The radar charts are divided into ten lines, each of them representing a 10% value. On each radar chart, data is shown as the frequency of individuals responding to an IgG subclass (n = 121). The data were analyzed considering a 95% confidence interval (CI). P < 0.05 was considered significant.

https://doi.org/10.1371/journal.pone.0258637.g004

When compared, the frequencies showed by both antigens (Pv-AMA-1 and tripeptide) have shown statistic similarity, except for subclass 1 (IgG 1) in which, for the tripeptide, we have 58.6% of recognition against 24.8% for PvAMA-1 (p ≤0.0001, Fisher’s exact test). Overall, the PvAMA-1 protein showed lower frequencies when compared to the four peptides, although in some cases the difference is not statistically significant (Fig 4F).

Peptide immunodominance within total IgG antibody response

In order to determine the immunodominance of each peptide, a depletion ELISA assay was performed. In this assay, reactivity against PvAMA-1 (IgG) was reduced substantially for all tested peptides (Fig 5). Respectively, the reduction was 6%, 12%, 26% and 42% for PI, PIII, PII and tripeptide peptides.

thumbnail
Fig 5. Immunodepletion showing specific antibody recognition to the synthetic peptides (PI, PII, PIII and tripeptide) in naturally P. vivax-infected individuals.

The sera were depleted with all four synthetic peptides and then evaluated for PvAMA-1. The Y-axis represents the mean antibody OD values (n = 121). The data were analyzed considering a 95% confidence interval (CI). P < 0.05 was considered significant.

https://doi.org/10.1371/journal.pone.0258637.g005

Discussion

Although it has been available for a considerable time, P. vivax genome and proteome has been little explored in terms of identifying vaccine targets. Accordingly, the search using computational analysis is a major draw, since it has been shown to be highly effective in identifying targets within Plasmodium species, in addition to providing optimization of research time and vaccine production [32]. Here in, we evaluated the sero-immunological response of individuals from the Brazilian Amazon naturally infected by P. vivax against peptide targets identified within an important and essential protein: PvAMA-1. The individuals profile included in the study indicates that all of them are residents of an endemic area for malaria. Most individuals reported having been infected previously (86.8%) and the large variation between the number of previous episodes, as well as the predominance of males among those affected, is most likely due to different levels of exposure that may be related to the personal occupation of each individual.

The major goal was to assess the immunogenic capacity of selected targets using in silico techniques and to compare it with the response obtained from the main protein—PvAMA-1—which is currently one of the main vaccine targets for malaria vivax [33, 34]. Data from previous studies carried out with rodents and non-human primates have shown that PvAMA-1 has already proved to be a promising target for inducing a protective immune response [10, 11, 35]. Several of them have confirmed its immunogenicity, especially in endemic areas such as the Brazilian Amazon [3638]. In addition, the functionality of AMA-1-related antibodies has also been assessed. This protein was proved to be a key component in the invasion process through the moving junction (MJ) along with the RON complex, in which anti-AMA-1 antibodies were able to inhibit the binding interaction between them [10, 11, 35, 39, 40]. In our assessment, we found that the selected peptides can be as immunogenic as the protein from which they were extracted. While for PvAMA-1 we have a total IgG response frequency of 57%, for subunits we found frequencies that varied between 32% - 62%, the largest of which came from the formulation containing the junction of the three peptides. In fact, with regard to Pv-AMA1, the response levels found corroborate with previous studies that evaluated the proteins immunogenic capacity [10, 4143].

Among the disadvantages in peptide-based vaccine constructions, low immunogenicity is the most relevant. When compared to conventional vaccine formulations, such as those using inactivated or attenuated pathogens, the immune response generated can be considerably weaker [44, 45]. This is a relevant factor since a robust activation usually characterizes greater protection and longevity of the immune response, two very desirable vaccine features. However, stronger adjuvants may overcome this obstacle. A few peptide-based vaccines for wide-impact diseases like leukemia [46], secondary progressive multiple sclerosis [47], and, more recently, SARS-Cov2 [48], have reached phase III studies this way. The latter has demonstrated efficacy of approximately 90% and is currently in the process of being approved for emergency use worldwide [49, 50]. Regarding to the tested targets, this does not appear to be an important limitation since the response obtained by three of the four peptides does not differ from the one induced by the entire protein. This data can be relevant when comparing the sizes of all antigenic targets (546aa, 54aa and 18aa for PvAMA-1, tripeptides and small peptides respectively) and considering the possibility of inserting the peptides in a chimeric construction containing multiple targets, which can generate an even more efficient response. Regarding to the response from the IgG subclasses, we found a similar pattern among small peptides with predominance of classes 2 and 3, highlighting the subclass 3. Individuals with high frequencies of IgG3 antibodies are known to have low parasitemia with clinical manifestations ranging from mild to moderate. For the tripeptide, a higher frequency of subclass 1 was observed. These data indicate that, in general, there is a dominant presence of cytophilic antibodies against peptide-based formulations among the tested individuals. It is well known that antibodies that belong to this class have the ability to activate effector cells of the immune system that can, therefore, play a protective role. Although it is not common, the relatively high frequency of IgG2 antibodies has also been observed in similar studies [51]. A study conducted in Ghana showed that the frequency of IgG2 antibodies in patients from malaria-endemic regions increased according to the individuals’ age, indicating that this subclass may be involved in acquired immunity [52]. However, it is known that non-cytophilic antibodies, such as the case of this group (IgG2), when acting against the same epitope, can undermine the protective effect of the cynophiles ones [53]. Nevertheless, the effective role of each subclass of antibodies in mediating protection against peptide-based antigens remains to be clarified.

Finally, the depletion assays demonstrated that the individuals’ antibodies can be quite specific against the studied antigens, with a recognition percentage of 6%, 12%, 26% and 42% for PI, PIII, PII and tripeptide respectively. In general, the results demonstrate that the peptides contain antigenic regions of extreme importance for the recognition of PvAMA-1, confirming its potential as possible targets for a chimeric composition of antigens. Of relevance, when tested against the serum of mice infected with Plasmodium berghei, the four peptides were 100% recognized (S3 Fig). The AMA-1 homology among the two species is around 50% [54] and, specifically amid the synthetic formulations, the amino acid overlapping can go from 33.4% up to 72.2% depending on the peptide. Whilst the common residues between the two of them may play a key role in antibody biding, further investigation on the matter, including an increase in the number of the P. berghei-infected subjects, is needed. Yet, this data is of considerable relevance since, in the future, a possible vaccine formulation will need to undergo studies in animal models and it is essential that there is homology in the recognition by the malaria species that are capable of infecting them.

Conclusion

Based on in silico approaches for choosing potential targets, the present study exhibit three new peptide antigens with considerable immunogenic capacity when evaluated individually and quite expressive when under joint synthesis. The identification and initial assessment of these four linear B-cell epitopes represents an excellent perspective with regard to future chimeric vaccine constructions that may come to contemplate several targets with the potential to generate the robust and protective immune response that a vivax malaria vaccine needs to succeed.

Supporting information

S1 Fig. Amino acid variability of three PvAMA-1 isolates sequences, from PlasmoDB.

The X-axis corresponds to the amino acid position, while the Y-axis corresponds to the number of variants observed in each position. Variants were defined when an amino acid did not match to the most commonly observed in a given position.

https://doi.org/10.1371/journal.pone.0258637.s001

(TIF)

S2 Fig. Characterization of the synthetic peptides by MALDI-TOF-TOF.

The x-axis represents mass/load, while y-axis defines intensity (arbitrary unity). (A) Peptide I (EEFRDYYENGEEKSNKQM). (B) Peptide II (SSGVRVDLGEDAEVENAK). (C) Peptide III (GDQRLKDGGFAFPNADDH). (D) Tripeptide (SSGVRVDLGEDAEVENAKGDQKLKDGGFAFPNANDHEEFRDYYENGEEKSNKQM).

https://doi.org/10.1371/journal.pone.0258637.s002

(TIF)

S3 Fig. Levels of specific total IgG antibodies in mice experimentally infected with Plasmodium berghei (n = 6).

Subjects with a Reactivity Index above 1 were considered positive. The R.I was calculated considering the mean OD of non-infected subjects (controls) +2SD (95% confidence interval).

https://doi.org/10.1371/journal.pone.0258637.s003

(TIF)

S1 Table. Presence of amino acids in each single position within PvAMA-1.

Rows corresponds to all amino acids belonging to PvAMA-1 (1–563) and columns represents a specific position within the protein (a—y). The numbers indicate how many times a given amino acid occurs at each position ranging from 0–64 times. Red boxes indicate regions corresponding to the peptides under study.

https://doi.org/10.1371/journal.pone.0258637.s004

(XLSX)

Acknowledgments

The authors would like to acknowledge the State Laboratory of Pathology and Clinical (LEPAC) and the CEPEM Clinical Trial Research Team (Porto Velho, RO, Brazil) for field and laboratory assistance.

References

  1. 1. Global Malaria Programme. World Malaria Report 2020: 20 years of global progress & challenges. Geneva; 2020.
  2. 2. Pan American Health Organization (PAHO)/World Health Organization (WHO). Epidemiological Update: Malaria in the Americas in the context of COVID-19 pandemic. Washington D.C; 2020.
  3. 3. Adams JH, Mueller I. The biology of plasmodium vivax. Cold Spring Harbor Perspectives in Medicine. 2017;7(9): 1–12.
  4. 4. White NJ, Imwong M. Relapse. Advances in Parasitology. 2012;80: 113–150. pmid:23199487
  5. 5. Remarque EJ, Faber BW, Kocken CHM, Thomas AW. Apical membrane antigen 1: a malaria vaccine candidate in review. Trends in Parasitology. 2008;24: 74–84. pmid:18226584
  6. 6. Salgado-Mejias P, Alves FL, Françoso KS, Riske KA, Silva ER, Miranda A, et al. Structure of Rhoptry Neck Protein 2 is essential for the interaction in vitro with Apical Membrane Antigen 1 in Plasmodium vivax. Malaria Journal. 2019;18(1). pmid:30683104
  7. 7. França ACB, Françoso KS, Marques RF, Trossini GHG, Gomes RA, Póvoa MM, et al. Antibodies Against the Plasmodium vivax Apical Membrane Antigen 1 From the Belem Strain Share Common Epitopes Among Other Worldwide Variants. Frontiers in Cellular and Infection Microbiology. 2021; 11:616230. pmid:33796476
  8. 8. Bargieri DY, Andenmatten N, Lagal V, Thiberge S, Whitelaw JA, Tardieux I, et al. Apical membrane antigen 1 mediates apicomplexan parasite attachment but is dispensable for host cell invasion. Nature Communications. 2013;4. pmid:24108241
  9. 9. Triglia et al. Apical membrane antigen 1 plays a central role in erythrocyte invasion by Plasmodium species. Molecular microbiology [Internet]. 2000;38(4):706–18. pmid:11115107
  10. 10. Bueno LL, Lobo FP, Morais CG, Mourão LC, de Ávila RAM, Soares IS, et al. Identification of a Highly Antigenic Linear B Cell Epitope within Plasmodium vivax Apical Membrane Antigen 1 (AMA-1). PLoS ONE. 2011;6(6). pmid:21713006
  11. 11. Seth RK, Bhat AA, Rao DN, Biswas S. Acquired immune response to defined Plasmodium vivax antigens in individuals residing in northern India. Microbes and Infection [Internet]. 2010;12(3):199–206. pmid:20034587
  12. 12. Rodrigues-Da-silva RN, da Silva JHM, Singh B, Jiang J, Meyer EVS, Santos F, et al. In silico identification and validation of α linear and naturally immunogenic B-cell epitope of the Plasmodium vivax malaria vaccine candidate merozoite surface protein-9. PLoS ONE. 2016;11(1):1–18.
  13. 13. George MT, Schloegel JL, Ntumngia FB, Barnes SJ, King CL, Casey JL, et al. Identification of an Immunogenic Broadly Inhibitory Surface Epitope of the Plasmodium vivax Duffy Binding Protein Ligand Domain. mSphere. 2019;4(3):1–14. pmid:31092602
  14. 14. Skwarczynski M, Toth I. Peptide-based synthetic vaccines. Chemical Science. 2016;7(2):842–54. pmid:28791117
  15. 15. Malonis RJ, Lai JR, Vergnolle O. Peptide-Based Vaccines: Current Progress and Future Challenges. Chemical Reviews. 2020;120(6):3210–29. pmid:31804810
  16. 16. Oyibo FO, Audu SI, Ajibade YE, Ahmed TA. Factors Influencing Malaria Incidence among Rural Farming Households: Evidence from Kogi Agricultural Zones. Asian Journal of Research in Infectious Diseases. 2020;9:1–9.
  17. 17. Lana R, Nekkab N, Siqueira AM, Peterka C, Marchesini P, Lacerda M, et al. The top 1%: quantifying the unequal distribution of malaria in Brazil. Malaria Journal. 20211;20(1).
  18. 18. Degarege A, Fennie K, Degarege D, Chennupati S, Madhivanan P. Improving socioeconomic status may reduce the burden of malaria in sub–Saharan Africa: A systematic review and meta-analysis. PLoS ONE. 2019;14(1). pmid:30677102
  19. 19. Aurrecoechea C, Brestelli J, Brunk BP, Dommer J, Fischer S, Gajria B, et al. PlasmoDB: A functional genomic database for malaria parasites. Nucleic Acids Research. 2009;37. pmid:18957442
  20. 20. Katoh K, Standley DM. MAFFT multiple sequence alignment software version 7: Improvements in performance and usability. Molecular Biology and Evolution. 2013;30(4):772–80. pmid:23329690
  21. 21. Shen W, Le S, Li Y, Hu F. SeqKit: A cross-platform and ultrafast toolkit for FASTA/Q file manipulation. PLoS ONE. 2016;1;11(10). pmid:27706213
  22. 22. Charif D, Lobry JR. SeqinR 1.0–2: A Contributed Package to the R Project for Statistical Computing Devoted to Biological Sequences Retrieval and Analysis [Internet]. Available from: http://www.R-project.org/.
  23. 23. Hadleyy Wickham. ggplot2 Elegant Graphics for Data Analysis [Internet]. 2nd ed. Available from: http://www.springer.com/series/6991.
  24. 24. Dhom-Lemos L, Viana AG, Cunha JLR, Cardoso MS, Mendes TAO, Pinheiro GRG, et al. Leishmania infantum recombinant kinesin degenerated derived repeat (rKDDR): A novel potential antigen for serodiagnosis of visceral leishmaniasis. PLoS ONE. 2019;14(1):1–17. pmid:30703138
  25. 25. Rodrigues MHC, Rodrigues KM, Oliveira TR, Cômodo AN, Rodrigues MM, Kocken CHM, et al. Antibody response of naturally infected individuals to recombinant Plasmodium vivax apical membrane antigen-1. International Journal for Parasitology. 2005;35(2):185–92. pmid:15710439
  26. 26. Santiago HC, Bennuru S, Boyd A, Eberhard M, Nutman TB. Structural and immunologic crossreactivity among filarial and mite tropomyosin: implications for the hygiene hypothesis. 2012;127(2):479–86.
  27. 27. Ma J, Wang S, Zhao F, Xu J. Protein threading using context-specific alignment potential. Bioinformatics. 2013;29(13). pmid:23812991
  28. 28. Xu J. Distance-based protein folding powered by deep learning. Proceedings of the National Academy of Sciences of the United States of America. 2019;116(34):16856–65. pmid:31399549
  29. 29. Källberg M, Wang H, Wang S, Peng J, Wang Z, Lu H, et al. Template-based protein structure modeling using the RaptorX web server. Nature Protocols. 2012;7(8):1511–22. pmid:22814390
  30. 30. Ma J, Peng J, Wang S, Xu J. A conditional neural fields model for protein threading. Bioinformatics. 2012;28(12). pmid:22321652
  31. 31. Peng J, Xu J. A multiple-template approach to protein threading. Proteins: Structure, Function and Bioinformatics. 2011;79(6):1930–9. pmid:21465564
  32. 32. Rappuoli R, Bottomley MJ, D’Oro U, Finco O, de Gregorio E. Reverse vaccinology 2.0: Human immunology instructs vaccine antigen design. Journal of Experimental Medicine. 2016;213(4):469–81. pmid:27022144
  33. 33. Chaurio RA, Pacheco MA, Cornejo OE, Durrego E, Stanley CE, Castillo AI, et al. Evolution of the Transmission-Blocking Vaccine Candidates Pvs28 and Pvs25 in Plasmodium vivax: Geographic Differentiation and Evidence of Positive Selection. PLoS Neglected Tropical Diseases. 2016;10(6):1–25. pmid:27347876
  34. 34. Mueller I, Shakri AR, Chitnis CE. Development of vaccines for Plasmodium vivax malaria. Vaccine. 2015;33(52):7489–95. pmid:26428453
  35. 35. Wickramarachchi T, Premaratne PH, Perera KLRL, Bandara S, Kocken CHM, Thomas AW, et al. Natural Human Antibody Responses to Plasmodium vivax Apical Membrane Antigen 1 under Low Transmission and Unstable Malaria Conditions in Sri Lanka. Society. 2006;74(1):798–801. pmid:16369044
  36. 36. Pires CV, Alves JRS, Lima BAS, Paula RB, Costa HL, Torres LM, et al. Blood-stage Plasmodium vivax antibody dynamics in a low transmission setting: A nine year follow-up study in the Amazon region. PLoS ONE. 2018;13(11): e0207244. pmid:30419071
  37. 37. Vicentin EC, Françoso KS, Rocha M v., Iourtov D, dos Santos FL, Kubrusly FS, et al. Invasion-inhibitory antibodies elicited by immunization with Plasmodium vivax apical membrane antigen-1 expressed in Pichia pastoris yeast. Infection and Immunity. 2014;82(3):1296–307. pmid:24379279
  38. 38. Soares RR, Nakaie CR, Rodrigues-da-Silva RN, da Silva RL, Lima-Junior J da C, Scopel KKG. Main B-cell epitopes of PvAMA-1 and PvMSP-9 are targeted by naturally acquired antibodies and epitope-specific memory cells in acute and convalescent phases of vivax malaria. Parasite Immunology. 2020;1;42(5). pmid:32096238
  39. 39. Normand BV le Saul FA, Hoos S Faber BW, Bentley GA. Cross-reactivity between apical membrane antigen 1 and rhoptry neck protein 2 in P. vivax and P. falciparum: A structural and binding study. PLoS ONE. 2017;1;12(8).
  40. 40. Bermúdez M, Arévalo-Pinzón G, Rubio L, Chaloin O, Muller S, Curtidor H, et al. Receptor–ligand and parasite protein–protein interactions in Plasmodium vivax: Analysing rhoptry neck proteins 2 and 4. Cellular Microbiology. 2018;1;20(7). pmid:29488316
  41. 41. Salavatifar M, Zakeri S, Mehrizi AA, Mirkhazemi S, Djadid ND. Evaluation of Naturally Acquired Antibody Responses to Two Variant Forms of Plasmodium vivax Apical Membrane. Archives of Iraninan medicine. 2015;18:35–8. pmid:26621016
  42. 42. Morais CG, Soares IS, Carvalho LH, Fontes CJF, Krettli AU, Braga ÉM. Antibodies to Plasmodium vivax apical membrane antigen 1: Persistence and correlation with malaria transmission intensity. American Journal of Tropical Medicine and Hygiene. 2006;75(4):582–7. pmid:17038677
  43. 43. Rocha MV, Françoso KS, Lima LC, Camargo TM, Machado RLD, Costa FTM, et al. Generation, characterization and immunogenicity of a novel chimeric recombinant protein based on Plasmodium vivax AMA-1 and MSP119. Vaccine. 2017;35(18):2463–72. pmid:28341111
  44. 44. Lei Y, Zhao F, Shao J, Li Y, Li S, Chang H, et al. Application of built-in adjuvants for epitope-based vaccines. PeerJ. 2019;2019(1). pmid:30656066
  45. 45. Azmi F, Fuaad AAHA, Skwarczynski M, Toth I. Recent progress in adjuvant discovery for peptide-based subunit vaccines. Vol. 10, Human Vaccines and Immunotherapeutics. Landes Bioscience. 2014;778–96. pmid:24300669
  46. 46. Qazilbash MH, Wieder E, Thall PF, Wang X, Rios R, Lu S, et al. PR1 peptide vaccine induces specific immunity with clinical responses in myeloid malignancies. Leukemia. 2017;31(3):697–704. pmid:27654852
  47. 47. Vandenbark AA, Culbertson NE, Bartholomew RM, Huan J, Agotsch M, LaTocha D, et al. Therapeutic vaccination with a trivalent T-cell receptor (TCR) peptide vaccine restores deficient FoxP3 expression and TCR recognition in subjects with multiple sclerosis. Immunology. 2008;123(1):66–78. pmid:17944900
  48. 48. Abduljaleel Z, Al-Allaf FA, Aziz SA. Peptides-based vaccine against SARS-nCoV-2 antigenic fragmented synthetic epitopes recognized by T cell and β-cell initiation of specific antibodies to fight the infection. Bio-Design and Manufacturing. 2021;4(3):490–505. pmid:33552630
  49. 49. Lei Y, Zhao F, Shao J, Li Y, Li S, Chang H, et al. Application of built-in adjuvants for epitope-based vaccines. PeerJ. 2019;2019(1):1–48. pmid:30656066
  50. 50. Azmi F, Fuaad AAHA, Skwarczynski M, Toth I. Recent progress in adjuvant discovery for peptide-based subunit vaccines. Human Vaccines and Immunotherapeutics. 2014;10(3):778–96. pmid:24300669
  51. 51. Matos A da S, Rodrigues-da-Silva RN, Soares IF, Baptista B de O, Souza RM de, Bitencourt-Chaves L, et al. Antibody Responses Against Plasmodium vivax TRAP Recombinant and Synthetic Antigens in Naturally Exposed Individuals From the Brazilian Amazon. Frontiers in Immunology. 2019;10:1–12. pmid:30723466
  52. 52. Dodoo D, Aikins A, Kusi KA, Lamptey H, Remarque E, Milligan P, et al. Cohort study of the association of antibody levels to AMA1, MSP1 19, MSP3 and GLURP with protection from clinical malaria in Ghanaian children. Malaria Journal. 2008;7:1–11. pmid:18173836
  53. 53. Afridi S, Atkinson A, Garnier S, Fumoux F, Rihet P. Malaria resistance genes are associated with the levels of IgG subclasses directed against Plasmodium falciparum blood-stage antigens in Burkina Faso. Malaria Journal. 2012;11:1–8. pmid:22947458
  54. 54. Madden Tom. The BLAST Sequence Analysis Tool. In: McEntyre J, Ostell J, editors. The NCBI Handbook. Bethesda: National Center for Biotechnology Information; 2021.