Skip to main content
Advertisement
Browse Subject Areas
?

Click through the PLOS taxonomy to find articles in your field.

For more information about PLOS Subject Areas, click here.

  • Loading metrics

An abscisic acid (ABA) homeostasis regulated by its production, catabolism and transport in peanut leaves in response to drought stress

  • Haitao Long,

    Roles Data curation, Formal analysis, Investigation, Methodology, Software, Visualization, Writing – original draft, Writing – review & editing

    Affiliation School of Life Sciences, South China Normal University, Guangzhou, China

  • Zhao Zheng,

    Roles Data curation, Formal analysis, Investigation, Methodology, Software, Visualization, Writing – original draft

    Affiliation College of Agriculture and Biology, Zhongkai University of Agriculture and Engineering, Guangzhou, China

  • Yajun Zhang,

    Roles Data curation, Formal analysis, Investigation, Methodology, Software, Writing – original draft, Writing – review & editing

    Affiliation College of Agriculture and Biology, Zhongkai University of Agriculture and Engineering, Guangzhou, China

  • Pengzhan Xing,

    Roles Formal analysis, Funding acquisition, Investigation, Project administration, Writing – original draft

    Affiliation College of Agriculture and Biology, Zhongkai University of Agriculture and Engineering, Guangzhou, China

  • Xiaorong Wan ,

    Roles Conceptualization, Data curation, Formal analysis, Funding acquisition, Investigation, Methodology, Project administration, Resources, Software, Supervision, Validation, Visualization, Writing – review & editing

    bioxrwan@hotmail.com (XW); liling502@126.com (LL)

    Affiliation College of Agriculture and Biology, Zhongkai University of Agriculture and Engineering, Guangzhou, China

  • Yixiong Zheng,

    Roles Resources, Supervision, Validation

    Affiliation College of Agriculture and Biology, Zhongkai University of Agriculture and Engineering, Guangzhou, China

  • Ling Li

    Roles Conceptualization, Funding acquisition, Project administration, Resources, Supervision, Validation, Writing – review & editing

    bioxrwan@hotmail.com (XW); liling502@126.com (LL)

    Affiliation School of Life Sciences, South China Normal University, Guangzhou, China

Abstract

ABA is an important messenger that acts as a signaling mediator for regulating the adaptive response of plants to drought stress. Two production pathways, de novo biosynthesis and hydrolysis of glucose-conjugated ABA by β-glucosidase (BG), increase cellular ABA levels in plants. ABA catabolism via hydroxylation by 8’-hydroxylase (CYP707A), or conjugation by uridine diphosphate glucosyltransferase (UGT), decreases cellular ABA levels. The transport of ABA through ATP-binding cassette (ABC)-containing transporter proteins, members of ABC transporter G family (ABCG), across plasma membrane (PM) is another important pathway to regulate cellular ABA levels. In this study, based on our previously constructed transcriptome of peanut leaves in response to drought stress, fourteen candidate genes involved in ABA production (including AhZEP, AhNCED1 and AhNCED3, AhABA2, AhAAO1 and AhAAO2, AhABA3, AhBG11 and AhBG24), catabolism (including AhCYP707A3, AhUGT71K1 and AhUGT73B4) and transport (including AhABCG22-1 and AhABCG22-2), were identified homologously and phylogenetically, and further analyzed at the transcriptional level by real-time RT-PCR, simultaneously determining ABA levels in peanut leaves in response to drought. The high sequence identity and very similar subcellular localization of the proteins deduced from 14 identified genes involved in ABA production, catabolism and transport with the reported corresponding enzymes in databases suggest their similar roles in regulating cellular ABA levels. The expression analysis showed that the transcripts of AhZEP, AhNCED1, AhAAO2 and AhABA3 instead of AhABA2, AhNCED3 and AhAAO1 in peanut leaves increased significantly in response to drought stress; and that the AhBG11 and AhBG24 mRNA levels were rapidly and significantly up-regulated, with a 4.83- and 4.58-fold increase, respectively at 2-h of drought stress. The genes involved in ABA catabolism AhCYP707A3, AhUGT71K1 instead of AhUGT73B4 were significantly induced in response to drought stress. The expression of two closely related peanut ABCG genes, AhABCG22.1 and AhABCG22.2, was significantly up-regulated in response to drought stress. The ABA levels rapidly began to accumulate within 2 h (a 56.6-fold increase) from the start of drought stress, and peaked at 10 h of the stress. The highly and rapidly stress up-regulated expressions of genes involved in ABA production and transport, particularly AhNCED1, AhBG11 and AhBG24, and AhABCG22.1 and AhABCG22.2, might contribute to the rapid ABA accumulation in peanut leaves in response to drought. In response to drought stress, ABA accumulation levels in peanut leaves agree well with the up-regulated expressions of ABA-producing genes (AhZEP, AhNCED1, AhAAO2, AhABA3, AhBG11 and AhBG24) and PM-localized ABA importer genes (AhABCG22-1 and AhABCG22-2), in spite of the simultaneously induced ABA catabolic genes (AhCYP707A3 and AhUGT71K1), although the induction of catabolic genes was much lower than that of biosynthetic gene (AhNCED1). This difference in induction kinetics of gene expression may define the significant accumulation of drought-induced ABA levels. These results suggest that ABA homeostasis in peanut leaves in response to drought maintained through a balance between the production, catabolism and transport, rather than simply by the biosynthesis.

Introduction

The plant hormone ABA plays pivotal roles in many important physiological processes including stomatal closure, seed dormancy, growth and various abiotic stress responses [1,2]. ABA is mainly produced by the de novo biosynthetic pathway through the oxidative cleavage of carotenoids [3]. In this pathway, zeaxanthin epoxidase (ZEP/ABA1) catalyzes the formation of all transviolaxthin from zeaxanthin [4]. Nine cis-epoxycarotenoid dioxygenase (NCED) cleaves carotenoids to form xanthoxin [5,6]. Xanthoxin is assumed to be transported from the plastids to the cytosol, although the precise mechanism that mediates this transport is not yet known [2]. The short-chain alcohol dehydrogenase/reductase (SDR/ABA2) converts xanthoxin derived from the cleavage of carotenoids into abscisic aldehyde [7,8], which is finally oxidized into ABA by abscisic aldehyde oxidase (AAO) [911]. Aldehyde oxidase requires the molybdenum cofactor sulfurase/ABA3 to produce a functional cofactor for its catalytic activity [12]. All of the steps of ABA de novo biosynthesis occur in plastids except for the final two stages, which take place in the cytosol [911].

An alternative pathway for producing ABA is via hydrolysis of ABA-glucosyl ester (ABA-GE), which is an inactive glucose-conjugated form of ABA. Intracellular ABA-GE can be hydrolysed by the two β-glucosidase (BG) homologs AtBG1 and AtBG2 in Arabidopsis [13,14], which localize to the endoplasmic reticulum (ER) and vacuole, respectively. The single-step reaction of β-glucosidase-regulated hydrolysis of ABA-GE to ABA is an ideal and important way to achieve the rapid increase in ABA contents necessary for plants to meet their physiological needs [14].

ABA catabolism is also a mechanism for regulating ABA levels. In Arabidopsis it proceeds mainly via two pathways, namely ABA 8’-hydroxylation catalyzed by ABA 8’-hydroxylase, the cytochrome P450 (CYP) 707A family [15], and ABA conjugation with glucose mediated by glucosyltransferases [16,17]. The 8′-hydroxylation of ABA is mediated by CYP707A family of proteins (CYP707As 1, 2, 3 and 4) in Arabidopsis [15]. We previously reported two genes (AhCYP707A1 and AhCYP707A2) encoding ABA 8’-hydroxylase from peanut [18]. The genes AhCYP707A1 and AhCYP707A2 were expressed ubiquitously in peanut roots, stems and leaves with different transcript levels, and were modulated osmotically [18]. The different spatial and temporal patterns of expression of four Arabidopsis and two peanut CYP707A genes, suggesting that each of the gene products may function in different physiological or developmental processes. The expression of all four Arabidopsis CYP707A genes was induced by dehydration stress and subsequent rehydration [15,19], which indicates that ABA levels are regulated by a balance between biosynthesis and catabolism, including feedback-induced catabolism. Conjugation of ABA with glucose is catalysed by ABA-uridine diphosphate (UDP) glucosyltransferases (UGTs), which include Arabidopsis UGT71B6 and its two closely related homologs, UGT71B7 and UGT71B8 [16,17]. A recent study has shown that UGT71B6, UGT71B7 and UGT71B8 play crucial roles in ABA homeostasis and adaptation to dehydration, osmotic and high-salinity stresses in Arabidopsis [17]. ABA catabolic pathways appear to be localized in the cytosol (UGT71Bs) and the ER membrane (CYP707As) [20].

Moreover, ABA and its metabolites are transported between subcellular compartments within a cell as well as between cells [2,20]. For the regulation of endogenous ABA level in plants, it is still crucial to determine how ABA transport is regulated, and whether it is involved in the control of physiological responses. The protonated ABA could be transported from relatively low-pH to high-pH cellular compartments via a passive diffusion that does not require specific transporters [21]. The first step in ABA transport might be ABA export out of cells. ABA is synthesized in the cytosol, where the pH is relative higher than that in the apoplastic space. Therefore a specific transporter may be required for ABA export to the apoplastic space. Recent studies in Arabidopsis have identified both ABA exporters and ABA importers localized to the plasma membrane (PM). ABA transporters were first identified in Arabidopsis, and they are ATP-binding cassette (ABC)-containing transporter proteins, members of ABC transporter G family [22,23]. AtABCG25, a half-size ABC transporter protein, is responsible for ABA export from vascular tissues in plants [22]; AtABCG40, a full-size ABC transporter, acts as an ABA importer in plant cells [23]. The discovery of AtABCG25 and AtABCG40 strongly suggests the existence of an active control of ABA transport between plant cells [22,23]. Kuromori et al [24] presented that AtABCG22 encodes a half-size ABC transporter with a function related to guard cell responses in Arabidopsis. Kang et al [25] have reported that four AtABCG proteins function together to deliver ABA from the endosperm to the embryo in mature imbibed seeds of Arabidopsis. AtABCG25 and AtABCG31, localized to the endosperm, export ABA from the endosperm to the embryo, whereas the embryo-localized AtABCG30 and AtABCG40 transport ABA into the embryo [25]. The low-affinity nitrate transporter (NRT1) was also reported to function as an ABA importing transporter (AIT1) [26,27]. Zhang et al [28] showed that AtDTX50 (Detoxification Efflux Carrier 50), a membrane protein in the MATE (Multidrug and Toxic Compound Extrusion) transporter family in Arabidopsis, mediated ABA efflux from the cytosol of vascular and guard cells. Recently, we have also isolated an ABA transporter-like 1 gene (AhATL1) from peanut plants, which modulated ABA sensitivity through specifically affecting ABA import into cells in transgenic Arabidopsis [29]. It appears that multiple types of transporters are involved in ABA transport in plants. Therefore, ABA-specific transporters localized to the plasma membrane also regulate the cellular ABA levels in plant cells.

Drought is one of the major abiotic stresses that limit the growth and production of plants. The mechanisms of drought stress response have been investigated most extensively in Arabidopsis, which include ABA-dependent and ABA-independent pathways [1,30,31]; ABA homoeostasis modulated by its production, inactivation, and transport is considered to play vital roles in plant development and stress responses; the transcriptional regulation of genes involved in either ABA production or ABA inactivation is of great importance in ABA homoeostasis [32]. However, our knowledge of the genes involved in regulation of ABA homoeostasis is relatively rare in agricultural crops in response to drought. We have used peanut, an economically important oil and protein rich crop, to address the issue [18,3342]. In the present study, based on the screening of our previously constructed transcriptome of peanut leaves in response to drought stress [38], we report the identification and expression analysis of genes encoding the enzymes involved in ABA production [including one ZEP (AhZEP), two NCEDs (AhNCED1 and AhNCED3), one ABA2 (AhABA2), two AAOs (AhAAO1 and AhAAO2), one ABA3 (AhABA3), and two BGs (AhBG11 and AhBG24)], catabolism [including one CYP707A (AhCYP707A3) and two UGTs (AhUGT71K1 and AhUGT73B4)], and transport [including two ABCGs (AhABCG22-1 and AhABCG22-2), which jointly contribute to the regulation of ABA homeostasis precisely in peanut leaves in response to drought.

Materials and methods

Plants and growth conditions

Seeds of peanut (Arachis hypogaea L. cv ‘Yueyou 7’) were sown in pots with a potting mixture of vermiculite, perlite and soil (1:1:1), and grown in a growth chamber with 16 h of light from fluorescent and incandescent lamps (200 μmol m-2 s-2) followed by 8 h of darkness at 28°C [18]. Plants were watered daily with half-strength Murashige and Skoog nutrient solution [43].

Drought stress treatment of plants

For the treatment of polyethylene glycol (PEG6000)-simulated drought stress, three-leaf-stage (10–15 days after planting) peanut plants were removed from the soil mixture carefully to avoid injury, and then hydroponically grown in a solution containing 20% (W/V) PEG6000 or deionized water as a control for indicated time, respectively. For all treatments, peanut leaves were frozen in liquid nitrogen immediately following the treatments and stored at -80°C until analysis. The entire experiments were biologically repeated at least three times.

Molecular cloning of genes encoding enzymes involved in ABA biosynthesis, catabolism and transport from peanut

From the constructed transcriptome which contained 47 842 assembled unigenes of three-leaf-stage peanut leaves in response to drought [38], we screened the fragments of genes encoding the enzymes involved in ABA production (including AhZEP, AhNCED1 and AhNCED3, AhABA2, AhAAO1 and AhAAO2, AhABA3, AhBG11 and AhBG24), catabolism (including AhCYP707A3, AhUGT71K1 and AhUGT73B4) and transport (including AhABCG22-1 and AhABCG22-2). The missing 5’ and 3’ ends of the screened genes were obtained by rapid amplification of cDNA ends (RACE) using the GeneRacer kit according to the manufacturer’s instructions (ThermoFisher, Shanghai, China). The gene specific primers for 5’ and 3’ RACE of target genes were listed in Table 1. In all cloning experiments, PCR fragments were gel-purified and ligated into the pMD 19-T Vector (TaKaRa, Dalian, China), and confirmed by sequencing from both strands.

thumbnail
Table 1. Primer sequences used in the present study.

https://doi.org/10.1371/journal.pone.0213963.t001

Sequence analyses and alignments

The Gene Runner (Hastings Software, Inc., New York, USA) was used to perform the routine sequence analyses. Web-based analyses of cDNAs and deduced amino acid sequences were carried out using the Basic Local Alignment Search Tool (BLAST) program at the National Center for Biotechnology Information Services [44]. Multiple alignments of deduced amino acid sequences from target genes were performed by using the Clustal W program in the BioEdit software (Isis Pharmaceuticals, Inc., Carlsbad, USA). The full-length protein sequences were phylogenetically analyzed by using the MEGA 4 software with a bootstrapping set of 1000 replicates [45]. The subcellular localization of target proteins was predicted by using the iPSORT algorithm [46] at the website: http://ipsort.hgc.jp/ and the WoLF PSORT tool at the website: http://www.genscript.com/wolf-psort.html.

Real-time quantitative RT-PCR performance

The isolated RNA by using the modified phenol chloroform method as previously described [33] was treated with RNase-free DNase I (TaKaRa, Dalian, China) at 37°C for 1 h to eliminate DNA contamination in real-time quantitative RT-PCR analysis. Reverse transcriptions (RT) were performed through the cDNA synthesis kit (TaKaRa, Dalian, China) according to the manufacturer’s and previously described protocols [18]. To investigate the expressions of target genes in peanut leaves in response to drought, the gene-specific primers were designed and listed in Table 1 to amplify the each corresponding cDNA for real-time quantitative PCR. As an internal control for normalization of target gene expression, the primers 18S-F (5’-ATT CCT AGT AAG CGC GAG TCA TCA G-3’) and 18S-R (5’-CAA TGA TCC TTC CGC AGG TTC AC-3’) specific to peanut 18S rRNA gene (GenBank accession no. AF156675) were used to amplify a fragment of 226 bp. Real-time quantitative PCRs were performed in the presence of Power SYBR green PCR Master Mix (Applied Biosystems, Guangzhou, China). Amplification was monitored in real-time with the MiniOpticonTM Real-Time PCR System (Bio-Rad, Shanghai, China). The products of real-time quantitative PCR were confirmed by determining the melt curves for the products at the end of each run, by analysis of the products using gel electrophoresis, and by sequencing. The comparative cycle threshold (Ct) method was used to quantify the normalized gene expression biologically and technically with three replicates [47]. All RT-PCR data were expressed as the mean ± standard error. Statistical differences in target genes’ expression were assessed by one-way analysis of variance (ANOVA) followed by the least significant difference (LSD) and Student-Neumann-Keuls (SNK) post hoc comparison through SPSS 13.0 software (SPSS Inc., Chicago, IL, USA) with the threshold of significance defined as p<0.05.

Measurement of endogenous ABA level

Endogenous ABA was isolated from the frozen leaf sample as described by Xiong et al [12]. Extraction in 80% (v/v) aqueous methanol, pre-purification through SepPak C18 cartridges (Waters, Milford, MA, USA), HPLC fractionation in a Kromasil C18 column (150×4.6 mm, 5 μm, Chenhang company, Shenzhen, China), and quantification of endogenous ABA were performed as reported previously [34,48]. The ABA level was determined triplicately with three replicates for each.

Results and discussion

Characterization of genes encoding enzymes involved in ABA production, catabolism and transport from peanut

From the constructed transcriptome of three-leaf-stage peanut leaves in response to drought [38], fourteen candidate genes involved in ABA production (AhZEP, AhNCED1 and AhNCED3, AhABA2, AhAAO1 and AhAAO2, AhABA3, AhBG11 and AhBG24), catabolism (AhCYP707A3, AhUGT71K1 and AhUGT73B4) and transport (AhABCG22-1 and AhABCG22-2), were screened and identified homologously and phylogenetically. The characteristics of the full-length cDNAs of fourteen screened target genes obtained by RACE and the corresponding deduced proteins were shown in Table 2.

thumbnail
Table 2. Characteristics of full-length cDNAs of fourteen screened target genes and corresponding deduced proteins.

https://doi.org/10.1371/journal.pone.0213963.t002

The main pathways of de novo ABA biosynthesis occur both in plastids and in the cytosol, starting from the precursor isopentenyl diphosphate (IPP), which is synthesized primarily in plastids from glyceraldehyde 3-phosphate and pyruvate, resulting in the successive production of the intermediates phytoene and lycopene [2,3]. Cyclization and hydroxylation of lycopene produce the oxygenated carotenoid zeaxanthin, which is then catalyzed by zeaxanthin epoxidase (ZEP) encoded by the Arabidopsis AtABA1 locus to synthesize the violaxanthin [49]. In the present study, from our constructed drought-induced transcriptome of peanut leaves, one candidate ZEP was identified as AhZEP, encoding the enzyme AhZEP which shared 81%, 79%, 78%, 73% and 73% sequence identity with Glycine soja GsZEP (KHN42080), Vigna radiata VrZEP1 (XP_022631763), Medicago truncatula MtZEP (XP_013453497), Medicago sativa (AIP98334), and Lupinus luteus LlZEP (AHI87686), respectively. AhZEP protein was predicted by the iPSORT algorithm to have a chloroplast transit peptide MMPMMLSWVLGGNSSKLEGRPVCCRLSDKA at the N-terminus.

In Arabidopsis, five AtNCEDs (AtNCED2, 3, 5, 6 and 9) were characterized to cleave the substrates violaxanthin and neoxanthin to a C15 product, xanthoxin (the first cytoplasmic precursor in ABA biosynthetic pathway) [50]. Here two candidate NCED genes, AhNCED1 (our previous work [33,34]) and AhNCED3 were characterized from the constructed drought-induced transcriptome of peanut leaves. Multiple alignments showed that the deduced amino acids from AhNCED1 and AhNCED3 shared 59.2% sequence identity with each other. AhNCED3 protein shared 60.2%, 62.2%, 61.9%, 47.9% and 54.7% sequence identity with Arabidopsis AtNCED2, 3, 5, 6 and 9, respectively. A putative 30-amino-acid chloroplast transit peptide MIMAPSSIALNSASSSTWAKKPHQLSRPFS predicted by the iPSORT algorithm is located at the N-terminus of AhNCED3 protein, structurally similar with reported NCED proteins [3,33,50,51]. Phylogenetic analysis of AhNCED1, AhNCED3 and five Arabidopsis NCEDs showed that AhNCED1 and AtNCED3 were clustered into one group (Fig 1), both of them playing a vital role in stress-induced ABA biosynthesis in leaves [34,50]. AhNCED3 was clustered with AtNCED2 and AtNCED5 (Fig 1), which accounted for the main NCED transcripts in flowers [50].

thumbnail
Fig 1. Phylogenetic analysis of amino acid sequences deduced from AhNCED1, AhNCED3, and five Arabidopsis NCEDs (AtNCED2, 3, 5, 6 and 9).

Multiple sequence alignment was performed using Clustal W and phylogenetic tree was constructed via the Neighbor-Joining method in MEGA 4 software. Bootstrap values from 1000 replicates for each branch were shown. GenBank accession numbers for each aligned NCED sequence were indicated in parentheses. The scale bar is 0.05.

https://doi.org/10.1371/journal.pone.0213963.g001

The conversion of xanthoxin into abscisic aldehyde is catalyzed by AtABA2 in Arabidopsis, which belongs to the short-chain dehydrogenases/reductases (SDR) family [7,8]. A severe ABA deficiency resulting from loss of function of AtABA2 suggests that AtABA2 protein appears to be encoded by a single gene in Arabidopsis genome [8]. In the present study, AhABA2 was characterized to encode AtABA2 homolog in peanut. Multiple alignments showed that AhABA2 protein shared 67.2%, 70% and 67.9 sequence identity with AtABA2, tomato SlABA2 and tobacco NtABA2, respectively (Fig 2A). The domain (residues 3 to 285 in AtABA2) with xanthoxin dehydrogenase activity was highly conserved in all aligned ABA2 proteins (Fig 2A). AhABA2 was phylogenetically closer to soybean GmABA2 in the leguminous cluster (Fig 2B).

thumbnail
Fig 2. Sequence analyses of ABA2 proteins from peanut, Arabidopsis, tomato, tobacco, soybean, alfalfa, and winter rape.

(A) Alignment of deduced amino acid sequences from peanut AhABA2, Arabidopsis AtABA2, tomato SlABA2, and tobacco NtABA2. Identical and similar amino acid residues were shaded in black and gray, respectively. Dotted lines indicated gaps that were introduced to maximize the alignment. Amino acids were numbered from the initial methionine. GenBank accession numbers for each aligned ABA2 homolog were indicated in parentheses. (B) Phylogenetic analysis of amino acid sequences of AhABA2, AtABA2, soybean GmABA2, alfalfa MtABA2, and winter rape BnABA2. Multiple sequence alignment was performed using Clustal W and phylogenetic tree was constructed via the Neighbor-Joining method in MEGA 4 software. Bootstrap values from 1000 replicates for each branch were shown. GenBank accession numbers for each analyzed ABA2 were indicated in parentheses. The scale bar is 0.05.

https://doi.org/10.1371/journal.pone.0213963.g002

The oxidation of abscisic aldehyde to ABA, which is catalyzed by abscisic aldehyde oxidase, is the final step in ABA biosynthetic pathway. Among four abscisic aldehyde oxidases (AtAAO1 to 4) in Arabidopsis, AtAAO3 was reported to actively utilize abscisic aldehyde as a substrate, most probably the only one AAO involved in ABA biosynthesis [11]. Here our previously characterized two peanut AAO genes, AhAAO1 [52] and AhAAO2 [53], were also screened from the constructed drought-induced transcriptome of peanut leaves. AhAAO1 protein was predicted to localize in the cytosol by the WoLF PSORT tool, and AhAAO2 was predicted by the iPSORT algorithm as not having any of signal, mitochondrial targeting, or chloroplast transit peptides. The aldehyde oxidase requires a molybdenum cofactor (MoCo) for its catalytic activity. To date, AtABA3 (a single-copy gene in the genome) was the only reported ABA3 gene encoding Arabidopsis sulfurase that produces a functional cofactor [12]. In this study, an AtABA3 homolog gene AhABA3 was characterized from the drought-induced transcriptome of peanut leaves. Multiple alignments showed that AhABA3 protein shared 82.1%, 80.9% and 61.3% sequence identity with soybean GmABA3, Cajanus cajan CcABA3 and AtABA3, respectively (Fig 3). The putative pyridoxal phosphate (PLP) binding motif and the conserved cysteine motif identified by Xiong et al [12] both exist in AhABA3 protein sequence (Fig 3).

thumbnail
Fig 3. Alignment of deduced amino acid sequences from peanut AhABA3, soybean GmABA3, Cajanus cajan CcABA3 and Arabidopsis AtABA3.

Identical and similar amino acid residues were shaded in black and gray, respectively. Dotted lines indicated gaps that were introduced to maximize the alignment. The conserved cysteine motif was underlined and the putative PLP binding motif was double underlined. The conserved critical lysine residue in the PLP domain was indicated with an upper asterisk, and the conserved cysteine residue was indicated with an upper square. Amino acids were numbered from the initial methionine. GenBank accession numbers for each aligned ABA3 homolog were indicated in parentheses.

https://doi.org/10.1371/journal.pone.0213963.g003

The hydrolysis of ABA-GE catalyzed by β-glucosidase (BG) is an alternative pathway to produce ABA. The β-glucosidase homologs, Arabidopsis AtBG1 and AtBG2, localize to the ER and vacuole, respectively [13,14]. AtBG2 belongs to the same subfamily as AtBG1 that consists of 16 members in the large number of β-glucosidases found in Arabidopsis [13,54], which can be divided into two groups: AtBG1 belongs to the group of seven members with an ER retrieval signal, and AtBG2 belongs to the other group of nine members without the ER retrieval signal [14]. In the present study, two BG homologs, AhBG11 and AhBG24, were characterized from our constructed drought-induced transcriptome of peanut leaves. AhBG11 protein shared 41.6%, 37.7% and 32.5% sequence identity with AhBG24, AtBG1 and AtBG2, respectively; and AhBG24 shared 40.2% and 37.2% sequence identity with AtBG1 and AtBG2, respectively (Fig 4). AhBG11 and AhBG24 were predicted by the WoLF PSORT tool to localize to the ER and vacuole, respectively (Table 2; Fig 4), suggesting that AhBG11 and AhBG24 might belong to the group with AtBG1 and the other group with AtBG2, respectively.

thumbnail
Fig 4. Alignment of deduced amino acid sequences from peanut AhBG11, AhBG24, and Arabidopsis AtBG1, AtBG2.

Identical and similar amino acid residues were shaded in black and gray, respectively. Dotted lines indicated gaps that were introduced to maximize the alignment. Putative ER-localization signal peptide was underlined in AtBG1 and AhBG11 [13]; and putative vacuolar-targeting motif was double underlined in AtBG2 and AhBG24 [14]. Amino acids were numbered from the initial methionine. GenBank accession numbers for each aligned BG homolog were indicated in parentheses.

https://doi.org/10.1371/journal.pone.0213963.g004

The catabolic process of ABA mainly involves two pathways, hydroxylation and glucose conjugation. The 8′-hydroxylation of ABA is the predominant enzymatic reaction, which is mediated by the protein encoded by AtCYP707A gene family (AtCYP707A1, 2, 3 and 4) in Arabidopsis [15]. In this study, from our transcriptome, another peanut CYP707A gene, AhCYP707A3 was identified, and AhCYP707A3 protein shared 84.4%, 50.9%, 65%, 54%, 68.2% and 53% sequence identity with AhCYP707A1, 2 (our previously characterized two peanut CYP707As [18]), and AtCYP707A1, 2, 3 and 4, respectively. Like AhCYP707A1 and 2, AhCYP707A3 contains the highly conserved cysteine motif (PFGNGTHSCPG), which was reported to be essential for the hydroxylation [55]. Three peanut CYP707A proteins (AhCYP707A1, 2 and 3) were all predicted as having a signal peptide by the iPSORT algorithm, consistent with the report of ER-membrane localized ABA catabolism catalyzed by CYP707As [20]. In the phylogenetic tree (Fig 5), AhCYP707A1, 3 and AtCYP707A1, 3 proteins were clustered into one group, and AhCYP707A3 was relatively closer to AhCYP707A1, consistent with the above result of sequence identity analysis.

thumbnail
Fig 5. Phylogenetic analysis of amino acid sequences deduced from three peanut (AhCYP707A1, 2 and 3) and four Arabidopsis (AtCYP707A1, 2, 3 and 4) CYP707A genes.

Multiple sequence alignment was performed using Clustal W and phylogenetic tree was constructed via the Neighbor-Joining method in MEGA 4 software. Bootstrap values from 1000 replicates for each branch were shown. GenBank accession numbers for each aligned CYP707A sequence were indicated in parentheses. The scale bar is 0.05.

https://doi.org/10.1371/journal.pone.0213963.g005

The main conjugation pathway for ABA is glucosylation catalyzed by ABA UDP-glucosyltransferases (UGTs), which produces ABA-GE, a storage form and an inactive end product of ABA metabolism [56,57]. Previously reported UGTs, UGT71B6, UGT71B7 and UGT71B8, UGT73B1 and UGT73B3, UGT75B1 and UGT75B2, UGT84B1 and UGT84B2, which displayed in vitro the activity to glucosylate ABA, belong to the UGT subfamilies of the family 1 in Arabidopsis [58]. In the present study, two unique ABA UGT genes, AhUGT71K1 and AhUGT73B4, were identified from the constructed drought-induced transcriptome of peanut leaves. Multiple alignments showed that AhUGT71K1 protein shared the highest sequence identity with Arabidopsis UGT71C5, which was very recently confirmed in vitro and in vivo to play a major role in ABA glucosylation for ABA homeostasis [58]. AhUGT73B4 shared the highest sequence identity with Arabidopsis UGT73B1, which displayed ABA glucosylation activity in vitro [58]. A motif, named as UDPGT [59], involved in binding to the donor sugar was highly conserved in the C-terminal sequences of all analyzed UGT proteins (Fig 6A). AhUGT71K1 and AhUGT73B4 were both predicted by the WoLF PSORT tool to localize in the cytosol, similar to the cytosolic localization of UGT71B6, UGT71B7, UGT71B8 and UGT71C5 [17,58]. Consistent with the result of sequence alignment, AhUGT71K1 and AhUGT73B4 were phylogenetically closer to UGT71C5 and UGT73B1, respectively (Fig 6B).

thumbnail
Fig 6. Sequence analyses of UGT proteins from peanut and Arabidopsis.

(A) Alignment of deduced amino acid sequences from peanut AhUGT71K1, AhUGT73B4 and Arabidopsis UGT71B6, UGT71C5, UGT73B1. Identical and similar amino acid residues were shaded in black and gray, respectively. Dotted lines indicated gaps that were introduced to maximize the alignment. The highly conserved motif UDPGT in all UGTs was boxed. Amino acids were numbered from the initial methionine. GenBank accession numbers for each aligned UGT homolog were indicated in parentheses. (B) Phylogenetic analysis of amino acid sequences of peanut AhUGT71K1, AhUGT73B4 and Arabidopsis UGT71B6, UGT71B7, UGT71B8, UGT71C5, UGT73B1. Multiple sequence alignment was performed using Clustal W and phylogenetic tree was constructed via the Neighbor-Joining method in MEGA 4 software. Bootstrap values from 1000 replicates for each branch were shown. GenBank accession numbers for each analyzed UGT were indicated in parentheses. The scale bar is 0.1.

https://doi.org/10.1371/journal.pone.0213963.g006

The translocation of ABA between cells, tissues and organs also plays important roles in whole plant physiological response to stress conditions. ABA can diffuse passively across biological membranes when it is protonated [21,60], and can also be transported across plasma membranes by ABCG transporters [61,62]. To date, at least eight different ABA transporters have been identified by genetic and functional screening [2229]. In the present study, two ABCG gene homologs, AhABCG22.1 and AhABCG22.2 were screened and characterized from our constructed drought-induced transcriptome of peanut leaves. Multiple alignments showed that AhABCG22.1 and AhABCG22.2 proteins shared 81% mutual sequence identity; AhABCG22.1 shared 75.6% and 36.7% sequence identity with Arabidopsis ABCG22 and ABCG25, respectively; AhABCG22.2 shared 75.3% and 37.8% sequence identity with Arabidopsis ABCG22 and ABCG25, respectively. The characterized domains ABC transporter G-25 (residues 111–746 and 123–726 respectively in AhABCG22.1 and AhABCG22.2) and ABC2_membrane (residues 501–703 and 483–685 respectively in AhABCG22.1 and AhABCG22.2) were highly conserved; the conserved features of ATP-binding site, ABC transporter signature motif, Walker A/P-loop and Walker B were also found in both AhABCG22.1 and AhABCG22.2 (Fig 7A). AhABCG22.1 and AhABCG22.2 were both predicted subcellularly as integral plasma membrane proteins. Phylogenetic tree of AhABCG22.1 and AhABCG22.2, and five Arabidopsis ABCGs (ABCG25, ABCG40, ABCG22, ABCG30 and ABCG31) demonstrated that AhABCG22.1 and AhABCG22.2 were clustered with ABCG22, and that all three were relatively closer to ABCG25 (Fig 7B).

thumbnail
Fig 7. Sequence analyses of ABCG proteins from peanut and Arabidopsis.

(A) Alignment of deduced amino acid sequences from peanut AhABCG22.1, AhABCG22.2 and Arabidopsis ABCG25, ABCG22. Identical and similar amino acid residues were shaded in black and gray, respectively. Dotted lines indicated gaps that were introduced to maximize the alignment. The highly conserved features of ATP-binding site, ABC transporter signature motif, Walker A/P-loop and Walker B in all ABCGs were respectively indicated with asterisks, a box, an underline and a double-underline. Amino acids were numbered from the initial methionine. GenBank accession numbers for each aligned ABCG homolog were indicated in parentheses. (B) Phylogenetic analysis of amino acid sequences of peanut AhABCG22.1, AhABCG22.2 and Arabidopsis ABCG25, ABCG40, ABCG22, ABCG30, ABCG31. Multiple sequence alignment was performed using Clustal W and phylogenetic tree was constructed via the Neighbor-Joining method in MEGA 4 software. Bootstrap values from 1000 replicates for each branch were shown. GenBank accession numbers for each analyzed ABCG were indicated in parentheses. The scale bar is 0.1.

https://doi.org/10.1371/journal.pone.0213963.g007

Expression pattern of genes involved in ABA production, catabolism and transport in peanut leaves in response to drought stress

It has been reported that, with the exception of AtABA2, the expressions of most of the genes involved in de novo biosynthesis of ABA are up-regulated by drought stress [812,49,63]. In contrast, AtABA2 is expressed constitutively at a relatively low level and is not induced by dehydration stress [7,8]. In the present study, real-time RT-PCR was performed to detect the expressions of the above characterized genes involved in ABA biosynthetic pathway in peanut leaves in response to drought stress. The results showed that gene expressions of AhZEP, AhNCED1, AhAAO2 and AhABA3 were significantly up-regulated in response to drought stress (Fig 8). Particularly, the transcript level of AhNCED1 gene was strongly increased by drought stress (756 times higher than that in the control at 10 h of the stress) (Fig 8B), consistent with our previous reports [18,34]. The expression of AhNCED3 (Fig 8D) was also induced by drought (0.9 times higher than that in the control at 10 h of the stress), but the induction was much slighter than that of AhNCED1 (Fig 8B, D). However, the expressions of AhABA2 (Fig 8C) and AhAAO1 (Fig 8E) were not affected significantly by the stress, which were consistent with the previous reports of AtABA2 [7,8] and AhAAO1 [52].

thumbnail
Fig 8.

Expressions of ABA biosynthetic genes, including AhZEP (A), AhNCED1 (B) and AhNCED3 (D), AhABA2 (C), AhAAO1 and AhAAO2 (E), and AhABA3 (F) in peanut leaves in response to drought stress. Peanut seedlings of twelve days old were hydroponically grown in the solution containing 20% PEG6000 or deionized water as a control for indicated time (The expressions of genes in peanut leaves during control conditions showed no obvious difference with that in 0 h stressed sample and were not presented). Total RNA was prepared respectively from leaves of control or stressed plants. Gene expressions detected by real-time quantitative RT-PCR were shown relative to the expression of peanut 18S rRNA gene in each sample. All data are presented as mean ± standard errors (SE) of three replicates. The asterisk above each bar indicates a significant difference between stressed and controlled samples at P < 0.05 (*) or P < 0.01 (**).

https://doi.org/10.1371/journal.pone.0213963.g008

Compared with the lengthy de novo biosynthetic pathway [3,56,64], the one-step hydrolysis of ABA-GE to ABA catalyzed by BG is a fast process, which is optimal to meet the rapid increase in ABA level in response to stresses. Arabidopsis AtBG1 and AtBG2 were both reported to be induced by dehydration stress [13,14]. Loss of AtBG1 [13] or AtBG2 [14] in Arabidopsis caused lower ABA levels and reduced abiotic stress tolerance, whereas overexpression of AtBG1 [13] or AtBG2 [14] resulted in higher ABA accumulation and enhanced tolerance to abiotic stress. In this study, the expressions of AhBG11 and AhBG24 genes in peanut leaves in response to drought stress were determined by real-time RT-PCR performance. As shown in Fig 9, the transcript levels of AhBG11 and AhBG24 were rapidly and significantly up-regulated by 2-h (4.83- and 4.58-fold increase, respectively) or 10-h (1.97- and 1.65-fold increase, respectively) drought stress.

thumbnail
Fig 9. β-glucosidase coding genes, including AhBG11 and AhBG24 in peanut leaves rapidly and highly respond to drought stress.

Peanut seedlings of twelve days old were hydroponically grown in the solution containing 20% PEG6000 or deionized water as a control for indicated time (The expressions of genes in peanut leaves during control conditions showed no obvious difference with that in 0 h stressed sample and were not presented). Total RNA was prepared respectively from leaves of control or stressed plants. Real-time RT-PCR analysis was performed as described in Fig 8. All data are presented as mean ± standard errors (SE) of three replicates. The asterisk above each bar indicates a significant difference between stressed and controlled samples at P < 0.05 (*).

https://doi.org/10.1371/journal.pone.0213963.g009

ABA catabolism is mediated through hydroxylation and glucose conjugation, and also plays important roles in regulating cellular ABA levels. The transcript levels of all four Arabidopsis CYP707A genes increased in response to mannitol or drought stress [15]. The CYP707A5 mRNA level in rice leaves sharply responded to mannitol [65]. We previously demonstrated that the transcript levels of peanut CYP707A1 and 2 genes increased in response to PEG6000- or NaCl-induced osmotic stress [18]. Here another peanut CYP707A gene, AhCYP707A3 was shown to be significantly induced in leaves in response to drought stress, with a 5.93- or an 8.85-fold increase in the transcript respectively at 2 or 10 h of the stress (Fig 10A). The conjugation of ABA with glucose is catalyzed by UGT to produce ABA-GE [16,17]. In Arabidopsis, UGT71B6 gene and its two homologs, UGT71B7 and UGT71B8 were all reported to be rapidly induced by osmotic stress [17]. Liu et al [58] showed that mutation of UGT71C5 and down-expression of UGT71C5 in Arabidopsis caused delayed seed germination and enhanced drought tolerance; and that overexpression of UGT71C5 accelerated seed germination and reduced drought tolerance. In the present study, the expression of AhUGT71K1, highly phylogenetically similar to UGT71B6 (Fig 6B), was rapidly and significantly up-regulated in peanut leaves in response to drought stress, with a 3.16- or 2.07-fold increase in the transcript respectively at 2 or 10 h of the stress (Fig 10B). Whereas, the transcript level of AhUGT73B4 in peanut leaves did not respond to drought stress markedly (Fig 10B).

thumbnail
Fig 10. Expressions of ABA catabolic genes, including AhCYP707A3, AhUGT71K1 and AhUGT73B4 in peanut leaves in response to drought stress.

Peanut seedlings of twelve days old were hydroponically grown in the solution containing 20% PEG6000 or deionized water as a control for indicated time (The expressions of genes in peanut leaves during control conditions showed no obvious difference with that in 0 h stressed sample and were not presented). Total RNA was prepared respectively from leaves of control or stressed plants. Real-time RT-PCR analysis was performed as described in Fig 8. All data are presented as mean ± standard errors (SE) of three replicates. The asterisk above each bar indicates a significant difference between stressed and controlled samples at P < 0.05 (*).

https://doi.org/10.1371/journal.pone.0213963.g010

Arabidopsis ABCG25 and ABCG40 were shown to be responsible for ABA transport and response, which function as an ABA exporter and importer, respectively [22,23]. Recently, the removal of PM-localized ABCG25 via activation of endocytosis and transport to vacuole was confirmed to be another mechanism by which plant cells increase cellular ABA levels in response to abiotic stresses, in addition to the activation of ABA biosynthetic genes [66]. Kuromori et al [24] showed that Arabidopsis ABCG22 is required for stomatal regulation and involved in ABA influx. In this study, the expressions of two closely related ABCG22 genes in peanut leaves, AhABCG22.1 and AhABCG22.2, were significantly up-regulated by 2-h (2.89- and 4.77-fold increase, respectively) or 10-h (1.93- and 2.54-fold increase, respectively) drought stress (Fig 11), respectively. Under abiotic stress conditions, plant cells need to increase the cellular ABA levels to trigger ABA-mediated signaling in order to respond to the stresses [49,67], therefore the expression levels of genes involved in ABA production pathways are up-regulated to increase the cellular ABA levels [812,49,63] (Figs 8 and 9). At this condition, high levels of AhABCG22 transcripts would contribute to the rapid increase of cellular ABA levels (Fig 11).

thumbnail
Fig 11. Drought stress significantly induces the expression of ABA importer genes, AhABCG22.1 and AhABCG22.2 in peanut leaves.

Peanut seedlings of twelve days old were hydroponically grown in the solution containing 20% PEG6000 or deionized water as a control for indicated time (The expressions of genes in peanut leaves during control conditions showed no obvious difference with that in 0 h stressed sample and were not presented). Total RNA was prepared respectively from leaves of control or stressed plants. Real-time RT-PCR analysis was performed as described in Fig 8. All data are presented as mean ± standard errors (SE) of three replicates. The asterisk above each bar indicates a significant difference between stressed and controlled samples at P < 0.05 (*).

https://doi.org/10.1371/journal.pone.0213963.g011

Genes involved in ABA production, catabolism and transport jointly regulate ABA homeostasis in peanut leaves in response to drought

ABA production, catabolism, and transport all affect ABA homeostasis in plant cells [2]. Two production pathways, de novo biosynthesis and hydrolysis of glucose-conjugated ABA, increase the cellular ABA levels [3,13,14,56,64]. ABA catabolism via hydroxylation or conjugation decreases the cellular ABA levels [62]. Although extensive work has been performed on the hydroxylation pathway, little is known about the conjugation pathway. In particular, the contribution of conjugation pathway in ABA homeostasis regulation has been less clear. Recently, the determination of ABA content in Arabidopsis showed that mutation in UGT71C5 and down-expression of UGT71C5 resulted in increased level of ABA, whereas overexpression of UGT71C5 resulted in reduced level of ABA [58]. The transport of ABA through ABCGs across the plasma membrane is another important pathway to regulate cellular ABA homeostasis [2224,62]. Consistent with this proposed activity, the ABA exporter atabcg25 mutants displayed ABA hypersensitive phenotypes at different developmental stages [22]. In contrast, AtABCG40/AtPDR12 is responsible for ABA uptake, which is consistent with the phenotype of atabcg40/atpdr12 that showed a defect in stomatal closure and enhanced water loss [23].

In the present study, the ABA level in peanut leaves in response to 0, 2, 4, 10, 14, 18, or 24 h of drought stress was respectively determined. As shown in Fig 12, the ABA level was significantly increased by drought stress. The ABA content rapidly began to accumulate within 2 h (a 56.6-fold increase) from the start of stress. The highly and rapidly stress up-regulated expressions of genes involved in ABA production and transport, particularly AhNCED1 (Fig 8B), AhBG11 and AhBG24 (Fig 9), and AhABCG22.1 and AhABCG22.2 (Fig 11), might contribute to the rapid ABA accumulation (Fig 12).

thumbnail
Fig 12. The ABA level in peanut leaves in response to 0, 2, 4, 10, 14, 18, or 24 h of drought stress.

The ABA levels in peanut leaves at the presence or absence of drought were determined triplicately for each sample (The ABA contents in peanut leaves during control conditions showed no obvious difference with that in 0 h stressed sample and were not presented). All data are presented as mean ± standard errors (SE) of three replicates. The asterisk above each bar indicates a significant difference between stressed and controlled samples at P < 0.01 (**).

https://doi.org/10.1371/journal.pone.0213963.g012

At 10 h of drought stress, the ABA level reached a peak, 95.9 times higher than that in the control (Fig 12). The ABA content then started to decrease at 18 h of the stress, and reduced to an even lower level than that of the normal (likely due to severe damages induced by drought stress) (Fig 12). ABA homeostasis maintained through a balance between the production, catabolism and transport, rather than simply by the biosynthesis. Consistent with this idea, the expressions of genes involved in ABA production (AhZEP, AhNCED1, AhABA3, AhAAO2, AhBG12 and AhBG24) (Figs 8 and 9), catabolism (AhCYP707A3 and AhUGT71K1) (Fig 10), and transport (AhABCG22.1 and AhABCG22.2) (Fig 11) were all up-regulated upon drought stress, although the induction of biosynthetic gene (AhNCED1) (Fig 8) was much higher than that of catabolic genes (AhCYP707A3 and AhUGT71K1) (Fig 10). This difference in induction kinetics of gene expression may define the significant accumulation of stress-induced ABA levels (Fig 12).

Conclusions

The two ABA-producing pathways, taking place in different compartments, coordinate to maintain the cellular ABA levels. Additionally, the catabolic pathways play a critical role in the regulation of cellular ABA levels. Furthermore, the PM-localized ABA-specific transporters also contribute to the regulation of cellular ABA levels in plant cells. The differential subcellular localization of all the key enzymes involved in ABA metabolism and transport indicates that integrated regulatory networks involving multiple organelles are implicated in the regulation of cellular ABA homeostasis. Identification of the components involved in the regulation of ABA homeostasis, including those that function in production and catabolism, as well as in transport between compartments, helps to understand the regulatory networks at the molecular level. Here we demonstrate that, in response to drought stress, ABA accumulation levels in peanut leaves agree well with the up-regulated expressions of ABA-producing genes and PM-localized ABA importer genes, although the expressions of ABA catabolic genes also increase, suggesting that ABA homeostasis in peanut leaves in response to drought may be coordinated by a master regulatory circuit that involves production, catabolism, and as well as transport.

References

  1. 1. Zhu J. K. Salt and drought stress signal transduction in plants. Annu. Rev. Plant Biol., 2002, 53, 247–273. pmid:12221975
  2. 2. Dong T., Park Y., Hwang I. Abscisic acid: Biosynthesis, inactivation, homoeostasis and signalling. Essays Biochem., 2015, 58, 29–48. pmid:26374885
  3. 3. Nambara E., Marion-Poll A. Abscisic acid biosynthesis and catabolism. Annu. Rev. Plant Biol., 2005, 56, 165–185. pmid:15862093
  4. 4. Marin E., Nussaume L., Quesada A., Gonneau M., Sotta B., Hugueney P., Frey A., Marion-Poll A. Molecular identification of zeaxanthin epoxidase of Nicotiana plumbaginifolia, a gene involved in abscisic acid biosynthesis and corresponding to the ABA locus of Arabidopsis thaliana. EMBO J., 1996, 15, 2331–2342. pmid:8665840
  5. 5. Schwartz S. H., Tan B. C., Gage D. A., Zeevaart J. A. D., McCarty D. R. Specific oxidative cleavage of carotenoids by VP14 of maize. Science, 1997, 276, 1872–1874. pmid:9188535
  6. 6. Tan B. C., Schwartz S. H., Zeevaart J. A. D., McCarty D. R. Genetic control of abscisic acid biosynthesis in maize. Proc. Natl. Acad. Sci. U.S.A., 1997, 94, 12235–12240. pmid:9342392
  7. 7. Gonzalez-Guzman M., Apostolova N., Belles J. M., Barrero J. M., Piqueras P., Ponce M. R., Micol J. L., Serrano R., Rodriquez P.L. The short-chain alcohol dehydrogenase ABA2 catalyzes the conversion of xanthoxin to abscisic aldehyde. Plant Cell, 2002, 14, 1833–1846. pmid:12172025
  8. 8. Cheng W. H., Endo A., Zhou L., Penney J., Chen H. C., Arroyo A., Leon P., Nambara E., Asami T., Seo M., Koshiba T., Sheen J. A unique short-chain dehydrogenase/reductase in Arabidopsis glucose signaling and abscisic acid biosynthesis and functions.Plant Cell, 2002, 14, 2723–2743. pmid:12417697
  9. 9. Seo M., Peeters A. J., Koiwai H., Oritani T., Marion-Poll A., Zeevaart J. A. D., Koorneef M., Kamiya Y., Koshiba T. The Arabidopsis aldehyde oxidase 3 (AAO3) gene product catalyzes the final step in abscisic acid biosynthesis in leaves. Proc. Natl. Acad. Sci. U.S.A., 2000, 97, 12908–12913. pmid:11050171
  10. 10. Seo M, Koiwai H., Akaba S., Komano T., Oritani T., Kamiya Y., Koshiba T. Abscisic aldehyde oxidase in leaves of Arabidopsis thaliana. Plant J., 2000, 23, 481–488. pmid:10972874
  11. 11. Seo M., Aoki H., Koiwai H., Kamiya Y., Nambara E., Koshiba T. Comparative studies on the Arabidopsis aldehyde oxidase (AAO) gene family revealed a major role of AAO3 in ABA biosynthesis in seeds. Plant Cell Physiol., 2004, 45, 1694–1703. pmid:15574845
  12. 12. Xiong L., Ishitani M., Lee H., Zhu J. K. The Arabidopsis LOS5/ABA3 locus encodes a molybdenum cofactor sulfurase and modulates cold and osmotic stress-responsive gene expression. Plant Cell, 2001, 13, 2063–2083. pmid:11549764
  13. 13. Lee K. H., Piao H. L., Kim H. Y., Choi S. M., Jiang F., Hartung W., Hwang I., Kwak J. M., Lee I. J., Hwang I. Activation of glucosidase via stress-induced polymerization rapidly increases active pools of abscisic acid. Cell, 2006, 126, 1109–1120. pmid:16990135
  14. 14. Xu Z. Y., Lee K. H., Dong T., Jeong J. C., Jin J. B., Kanno Y., Kim D. H., Kim S. Y., Seo M., Bressan R. A., Yun D. J., Hwang I. A vacuolar beta-glucosidase homolog that possesses glucoseconjugated abscisic acid hydrolyzing activity plays an important role in osmotic stress responses in Arabidopsis. Plant Cell, 2012, 24, 2184–2199. pmid:22582100
  15. 15. Saito S., Hirai N., Matsumoto C., Ohigashi H., Ohta D., Sakata K., Mizutani M. Arabidopsis CYP707As encode (+)-abscisic acid 8’-hydroxylase, a key enzyme in the oxidative catabolism of abscisic acid. Plant Physiol., 2004, 134, 1439–1449. pmid:15064374
  16. 16. Priest D. M., Ambrose S. J., Vaistij F. E., Elias L., Higgins G. S., Ross A. R. S., Abrams S. R., Bowles D. J. Use of the glucosyltransferase UGT71B6 to disturb abscisic acid homeostasis in Arabidopsis thaliana. Plant J., 2006, 46, 492–502. pmid:16623908
  17. 17. Dong T., Xu Z. Y., Park Y., Kim D. H., Lee Y., Hwang I. ABA UDP glucosyltransferases play a crucial role in ABA homeostasis in Arabidopsis. Plant Physiol., 2014, 165, 277–289. pmid:24676855
  18. 18. Liu S., Lv Y., Wan X.-R., Li L.-M., Hu B., Li L. Cloning and expression analysis of cDNAs encoding ABA 8’-hydroxylase in peanut plants in response to osmotic stress. PLoS ONE, 2014, 9, e97025. pmid:24825163
  19. 19. Umezawa T., Okamoto M., Kushiro T., Nambara E., Oono Y., Seki M., Kobayashi M., Koshiba T., Kamiya Y., Shinozaki K. CYP707A3, a major ABA 8’-hydroxylase involved in dehydration and rehydration response in Arabidopsis thaliana. Plant J., 2006 46, 171–182. pmid:16623881
  20. 20. Seo M., Koshiba T. Transport of ABA from the site of biosynthesis to the site of action. J. Plant Res., 2011, 124, 501–507. pmid:21416315
  21. 21. Wilkinson S., Davies W. J. ABA-based chemical signaling: the co-ordination of responses to stress in plants. Plant Cell Environ., 2002, 25, 195–210. pmid:11841663
  22. 22. Kuromori T., Miyaji T., Yabuuchi H., Shimizu H., Sugimoto E., Kamiya A., Moriyama Y., Shinozaki K. ABC transporter AtABCG25 is involved in abscisic acid transport and responses. Proc. Natl. Acad. Sci. U.S.A., 2010, 107, 2361–2366. pmid:20133881
  23. 23. Kang J., Hwang J. U., Lee M., Kim Y. Y., Assmann S. M., Martinoia E., Lee Y. PDR-type ABC transporter mediates cellular uptake of the phytohormone abscisic acid. Proc. Natl. Acad. Sci. U.S.A., 2010, 107, 2355–2360. pmid:20133880
  24. 24. Kuromori T., Sugimoto E., Shinozaki K. Arabidopsis mutants of AtABCG22, an ABC transporter gene, increase water transpiration and drought susceptibility. Plant J., 2011, 67, 885–894. pmid:21575091
  25. 25. Kang J., Yim S., Choi H., Kim A., Lee K. P., Lopez-Molina L., Martinoia E., Lee Y. Abscisic acid transporters cooperate to control seed germination. Nature Commun, 2015, 6, 8113.
  26. 26. Kanno Y., Hanada A., Chiba Y., Ichikawa T., Nakazawa M., Matsui M., Koshiba T., Kamiya Y., Seo M. Identification of an abscisic acid transporter by functional screening using the receptor complex as a sensor. Proc. Natl Acad. Sci. U.S.A., 2012, 109, 9653–9658. pmid:22645333
  27. 27. Léran S., Varala K., Boyer J. C., Chiurazzi M., Crawford N., Daniel-Vedele F., David L., Dickstein R., Fernandez E., Forde B., Gassmann W., Geiger D., Gojon A., Gong J. M., Halkier B. A., Harris J. M., Hedrich R., Limami A. M., Rentsch D., Seo M., Tsay Y. F., Zhang M., Coruzzi G., Lacombe B. A unified nomenclature of NITRATE TRANSPORTER 1/PEPTIDE TRANSPORTER family members in plants. Trends Plant Sci., 2014, 19, 5–9. pmid:24055139
  28. 28. Zhang H., Zhu H., Pan Y., Yu Y., Luan S., Li L. A DTX/MATE-type transporter facilitates abscisic acid efflux and modulates ABA sensitivity and drought tolerance in Arabidopsis. Mol. Plant, 2014, 7, 1522–1532. pmid:24851876
  29. 29. Ge K., Liu X., Li X., Hu B., Li L. Isolation of an ABA transporter-like 1 gene from Arachis hypogaea that affects ABA import and reduces ABA sensitivity in Arabidopsis. Front. Plant Sci., 2017, 8, 1150. pmid:28713410
  30. 30. Bray E A. Plant responses to water deficit. Trends Plant Sci., 2002, 2, 48–54.
  31. 31. Shinozaki K., Yamaguchi-Shinozaki K. Gene expression and signal transduction in water-stress response. Plant Physiol., 1997, 115, 327–334. pmid:12223810
  32. 32. Ma Y., Cao J., He J., Chen Q., Li X., Yang Y. Molecular mechanism for the regulation of ABA homeostasis during plant development and stress responses. Int. J. Mol. Sci., 2018, 19, 3643.
  33. 33. Wan X., Li L. Molecular cloning and characterization of a dehydration-inducible cDNA encoding a putative 9-cis-epoxycarotenoid dioxygenase in Arachis hypogaea L. DNA Seq., 2005, 16, 217–223. pmid:16147878
  34. 34. Wan X., Li L. Regulation of ABA level and water-stress tolerance of Arabidopsis by ectopic expression of a peanut 9-cis-epoxycarotenoid dioxygenase gene. Biochem. Biophys. Res. Commun., 2006, 347, 1030–1038. pmid:16870153
  35. 35. Liang J., Yang L., Chen X., Li L., Guo D., Li H., Zhang B. Cloning and characterization of the promoter of the 9-cis-epoxycarotenoid dioxygenase gene in Arachis hypogaea L. Biosci. Biotechnol. Biochem., 2009, 73, 2103–2106. pmid:19734653
  36. 36. Wan X., Mo A., Liu S., Yang L., Li L. Constitutive expression of a peanut ubiquitin-conjugating enzyme gene in Arabidopsis confers improved water-stress tolerance through regulation of stress-responsive gene expression. J. Biosci. Bioengin., 2011, 111, 478–484.
  37. 37. Liu X., Hong L., Li X. Y., Yao Y., Hu B., Li L. Improved drought and salt tolerance in transgenic Arabidopsis overexpressing a NAC transcriptional factor from Arachis hypogaea. Biosci. Biotechnol. Biochem., 2011, 75, 443–450. pmid:21389632
  38. 38. Li X., Lu J., Liu S., Liu X., Lin Y., Li L. Identification of rapidly induced genes in the response of peanut (Arachis hypogaea) to water deficit and abscisic acid. BMC Biotechnol., 2014, 14, 58. pmid:24970488
  39. 39. Hu B., Cao J., Ge K., Li L. The site of water stress governs the pattern of ABA synthesis and transport in peanut. Sci. Rep., 2016, 6, 32143. pmid:27694957
  40. 40. Liu S., Li M., Su L., Ge K., Li L., Li X., Liu X., Li L. Negative feedback regulation of ABA biosynthesis in peanut (Arachis hypogaea): a transcription factor complex inhibits AhNCED1 expression during water stress. Sci. Rep., 2016, 6, 37943. pmid:27892506
  41. 41. Liu X., Li L., Li M., Su L., Lian S., Zhang B., Li X., Ge K., Li L. AhGLK1 affects chlorophyll biosynthesis and photosynthesis in peanut leaves during recovery from drought. Sci. Rep., 2018, 8, 2250. pmid:29396501
  42. 42. Zhang B., Su L., Hu B., Li L. Expression of AhDREB1, an AP2/ERF transcription factor gene from peanut, is affected by histone acetylation and increases abscisic acid sensitivity and tolerance to osmotic stress in Arabidopsis. Int. J. Mol. Sci., 2018, 19, 1441.
  43. 43. Murashige T., Skoog F. A revised medium for rapid growth and bioassay with tobacco tissue cultures. Physiol. Plant, 1962, 15, 473–497.
  44. 44. Altschul S. F., Gish W., Miller W., Myers E. W., Lipman D. Basic local alignment search tool. J. Mol. Biol., 1990, 215, 403–410. pmid:2231712
  45. 45. Tamura K., Dudley J., Nei M., Kumar S. MEGA4: Molecular evolutionary genetics analysis (MEGA) software version 4.0. Mol. Biol. Evol., 2007, 24, 1596–1599. pmid:17488738
  46. 46. Bannai H., Tamada Y., Maruyama O., Nakai K, Miyano S. Extensive feature detection of N-terminal protein sorting signals. Bioinformatics, 2002, 18: 298–305. pmid:11847077
  47. 47. Muller P. Y., Janovjak H., Miserez A. R., Dobbie Z. Processing of gene expression data generated by quantitative real-time RT-PCR. Biotechniques, 2002, 32, 1372–1379. pmid:12074169
  48. 48. Chen X.M., Wang S.S. Quantitative analysis of ABA, IAA, and NAA in plant tissues by HPLC. Plant Physiol. Commun., 1992, 28, 368–371.
  49. 49. Xiong L., Lee H., Ishitani M., Zhu J. K. Regulation of osmotic stress responsive gene expression by the LOS6/ABA1 locus in Arabidopsis. J. Bio. Chem., 2002, 277, 8588–8596.
  50. 50. Tan B. C., Joseph L. M., Deng W. T., Liu L., Li Q. B., Cline K., McCarty D. R. Molecular characterization of the Arabidopsis 9-cis-epoxycarotenoid dioxygenase gene family. Plant J., 2003, 35, 44–56. pmid:12834401
  51. 51. Huang Y., Guo Y., Liu Y., Zhang F., Wang Z., Wang H., Wang F., Li D., Mao D., Luan S., Liang M., Chen L. 9-cis-Epoxycarotenoid dioxygenase 3 regulates plant growth and enhances multi-abiotic stress tolerance in rice. Front. Plant Sci., 2018, 9, 162. pmid:29559982
  52. 52. Yang L., Liang J., Li H., Li L. Cloning and expression analysis of an aldehyde oxidase gene in Arachis hypogaea L. J. Environ. Biol., 2009, 30, 93–98. pmid:20112869
  53. 53. Yang L., Liang J., Zhou W., Su L., Zhang B., Li L. Isolation and characterization of the aldehyde oxidase 2 gene from Arachis hypogaea L. Plant Mol. Biol. Rep., 2011, 29, 544–553.
  54. 54. Xu Z., Escamilla-Treviño L., Zeng L, Lalgondar M., Bevan D., Winkel B., Mohamed A., Cheng C. L., Shih M. C., Poulton J., Esen A. Functional genomic analysis of Arabidopsis thaliana glycoside hydrolase family 1. Plant Mol. Biol., 2004, 55, 343–367. pmid:15604686
  55. 55. Kushiro T., Okamoto M., Nakabayashi K., Yamagishi K., Kitamura S., Asami T., Hirai N., Koshiba ., Kamiya Y., Nambara E. The Arabidopsis cytochrome P450 CYP707A encodes ABA 89-hydroxylases: Key enzymes in ABA catabolism. EMBO J., 2004, 23, 1647–1656. pmid:15044947
  56. 56. Zeevaart J. A. D. In Biochemistry and Molecular Biology of Plant Hormones, ed. Hooykaas P. J. J., Hall M. A., Libbebga K. R. Abscisic acid metabolism and its regulation, Elsevier, Amsterdam, 1999, pp. 189–207.
  57. 57. Sauter A., Dietz K. J., Hartung W. A possible stress physiological role of abscisic acid conjugates in root-to-shoot signaling. Plant Cell Environ., 2002, 25, 223–228. pmid:11841665
  58. 58. Liu Z., Yan J.-P., Li D.-K., Luo Q., Yan Q., Liu Z.-B., Ye L.-M., Wang J.-M., Li X.-F., Yang Y. UDP-glucosyltransferase71C5, a major glucosyltransferase, mediates abscisic acid homeostasis in Arabidopsis. Plant Physiol., 2015, 167, 1659–1670. pmid:25713337
  59. 59. Osmani S. A., Bak S., Møller B. L. Substrate specificity of plant UDP-dependent glycosyltransferases predicted from crystal structures and homology modeling. Phytochemistry, 2009, 70, 325–347. pmid:19217634
  60. 60. Ng L. M., Melcher K., Teh B. T., Xu H. E. Abscisic acid perception and signaling: structural mechanisms and applications. Acta Pharmacol. Sin., 2014, 35, 567–584. pmid:24786231
  61. 61. Boursiac Y., Leran S., Corratge-Faillie C., Gojon A., Krouk G., Lacombe B. ABA transport and transporters. Trends Plant Sci., 2013, 18, 325–333. pmid:23453706
  62. 62. Sah S. K., Reddy K. R., Li J. Abscisic acid and abiotic stress tolerance in crop plants. Front. Plant Sci., 2016, 7, 571. pmid:27200044
  63. 63. Iuchi S., Kobayashi M., Taji T., Naramoto M., Seki M., Kato T., Tabata S., Kakubari Y., Yamaguchi-Shinozaki K., Shinozaki K. Regulation of drought tolerance by gene manipulation of 9-cis-epoxycarotenoid dioxygenase, a key enzyme in abscisic acid biosynthesis in Arabidopsis. Plant J., 2001, 27, 325–333. pmid:11532178
  64. 64. Xu Z.-Y., Kim D. H., Hwang I. ABA homeostasis and signaling involving multiple subcellular compartments and multiple receptors. Plant Cell Rep., 2013, 32, 807–813. pmid:23430173
  65. 65. Yang S. H., Choi D. Characterization of genes encoding ABA 8'-hydroxylase in ethylene-induced stem growth of deepwater rice (Oryza sativa L.). Biochem. Biophys. Res. Commun., 2006, 350, 685–690. pmid:17022939
  66. 66. Park Y., Xu Z.-Y., Kim S. Y., Lee J., Choi B., Lee J., Kim H., Sim H.-J., Hwang I. Spatial regulation of ABCG25, an ABA exporter, is an important component of the mechanism controlling cellular ABA levels. Plant Cell, 2016, 28, 2528–2544. pmid:27697789
  67. 67. Cramer G. R., Urano K., Delrot S., Pezzotti M., Shinozaki K. Effects of abiotic stress on plants: a systems biology perspective. BMC Plant Biol., 2011, 11, 163. pmid:22094046