Figures
Abstract
Wheat is an important staple food and potent allergen source. Recently, we isolated a cDNA coding for wheat alpha-purothionin which is recognized by wheat food allergic patients at risk for severe wheat-induced allergy. The purpose of the present study was the biochemical, biophysical and IgE epitope characterization of recombinant alpha-purothionin. Synthetic genes coding for alpha-purothionin were expressed in a prokaryotic system using Escherichia coli and in a eukaryotic expression system based on baculovirus-infected Sf9-insect cells. Recombinant proteins were purified and characterized by SDS-PAGE, mass spectrometry, circular dichroism, chemical cross-linking and size exclusion chromatography. Five overlapping peptid were synthesized for epitope mapping. Alpha-purothionin-specific rabbit antibodies were raised to perform IgE-inhibition experiments and to study the resistance to digestion. The IgE reactivity of the proteins and peptides from ten wheat food allergic patients was studied in non-denaturing RAST-based binding assays. Alpha-purothionin was expressed in the prokaryotic (EcTri a 37) and in the eukaryotic system (BvTri a 37) as a soluble and monomeric protein. However, circular dichroism analysis revealed that EcTri a 37 was unfolded whereas BvTri a 37 was a folded protein. Both proteins showed comparable IgE-reactivity and the epitope mapping revealed the presence of sequential IgE epitopes in the N-terminal basic thionin domain (peptide1:KSCCRSTLGRNCYNLCRARGAQKLCAGVCR) and in the C-terminal acidic extension domain (peptide3:KGFPKLALESNSDEPDTIEYCNLGCRSSVC, peptide4:CNLGCRSSVCDYMVNAAADDEEMKLYVEN). Natural Tri a 37 was digested under gastric conditions but resistant to duodenal digestion. Immunization with EcTri a 37 induced IgG antibodies which recognized similar epitopes as IgE antibodies from allergic patients and inhibited allergic patients' IgE binding. Reactivity to Tri a 37 does not require a folded protein and the presence of sequential IgE epitopes indicates that sensitization to alpha-purothionin occurs via the gut. Both allergens can be used for in-vitro diagnosis of wheat food allergy. The induction of blocking IgG antibodies suggests the usefulness for immunotherapy.
Citation: Pahr S, Selb R, Weber M, Focke-Tejkl M, Hofer G, Dordić A, et al. (2014) Biochemical, Biophysical and IgE-Epitope Characterization of the Wheat Food Allergen, Tri a 37. PLoS ONE 9(11): e111483. https://doi.org/10.1371/journal.pone.0111483
Editor: Simon Patrick Hogan, Cincinnati Children's Hospital Medical Center, University of Cincinnati College of Medicine, United States of America
Received: June 16, 2014; Accepted: October 2, 2014; Published: November 4, 2014
Copyright: © 2014 Pahr et al. This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited.
Data Availability: The authors confirm that all data underlying the findings are fully available without restriction. All relevant data are within the paper.
Funding: This study was supported by research grants from Phadia-Thermo Fisher, Uppsala, Sweden, the Christian Doppler Research Association, Austria, project F4605 of the Austrian Science Fund (FWF) and in part by the European Commission's Seventh Framework program under grant agreement no. 261357. The funders had no role in study design, data collection and analysis, decision to publish, or preparation of the manuscript.
Competing interests: Rudolf Valenta has served as a consultant for Phadia/Thermofisher, Uppsala, Sweden and has received research grants from this company. The other authors have no conflict of interest to declare. However, this does not alter the authors' adherence to PLOS ONE policies on sharing data and materials.
Introduction
Wheat is one of the most important components of our daily nutrition. It contains several essential dietary constituents such as carbohydrates, fats, dietary fibers, minerals, proteins, vitamins and water. [1] However, wheat also belongs to the most important allergy-eliciting foods causing local manifestations as well as severe systemic reactions. [2] In fact, in a population of wheat food allergic children more than 50% had experienced anaphylaxis upon wheat ingestion [3] and wheat has been reported as one of the major food allergen sources involved in food-induced anaphylaxis in a study analysing 1000 patients with food allergy. [4] However, only a few allergen molecules have been identified to be involved in severe allergy to wheat. Among the known wheat food allergens, ω5-gliadin (Tri a 19) [5], α/β-gliadins (Tri a 21) [6] and HMW glutenin (Tri a 26) [7] have been described as markers for wheat-dependent exercise-induced anaphylaxis. Furthermore, LTP (lipid transfer protein; Tri a 14) [8] was reported to play an important role in the development of wheat-induced anaphylaxis.
Very recently we identified a novel wheat food allergen, alpha purothionin, which according to the allergen nomenclature system was designated Tri a 37. In 20% of wheat food allergic patients we found IgE reactivity to Tri a 37 which was associated with a four-fold increased risk of experiencing severe wheat-induced anaphylaxis. [9]
The latter finding suggested that Tri a 37 may be a true wheat food allergen (class I food allergen). [9] Class I food allergens usually contain sequential epitopes and sensitization occurs mainly via the gastrointestinal tract. [10], [11] The wheat allergens ω5-gliadin, the HMW glutenins [7], [12] as well as allergens from other food allergen sources, such as egg (ovomucoid) [13] and cow's milk (alpha-, beta-casein) are examples for class I food allergens. [14]
Here we report the recombinant expression of Tri a 37 in a prokaryotic system using Escherichia coli cells (EcTri a 37) and in an eukaryotic system (baculovirus infected insect cells - BvTri a 37) which yielded an unfolded and a folded form of Tri a 37 and thus allowed us to study the potential relevance of conformational IgE epitopes. Both allergens were characterized regarding biochemical and biophysical properties. A detailed IgE epitope mapping of Tri a 37 was performed with synthetic peptides spanning the complete Tri a 37 sequence. Furthermore, we raised a rabbit antiserum against Tri a 37 to study the natural Tri a 37 under conditions of gastric and duodenal digestion in wheat extract and performed IgE-inhibition experiments to investigate the protective activity of IgG antibodies induced by immunization with Tri a 37.
Materials and Methods
Recombinant production of EcTri a 37
The cDNA coding for the mature Tri a 37 with a 3′ sequence coding for a hexahistidine tag was produced as synthetic gene with codons optimized for expression in E.coli and subcloned into the pET17b expression vector (ATG-biosynthetics, Merzhausen, Germany). The recombinant allergen was then expressed in E.coli BL21 (DE3) cells and purified by nickel affinity chromatography from the inclusion body fraction (Quiagen, Hilden, Germany). [15] The purified recombinant allergen EcTri a 37 was eluted from the column in 8 M urea, 100 mM NaH2PO4, 10 mM Tris, pH 4.6, then dialyzed step-wise against 10 mM NaH2PO4 buffer pH 4.0 in which it remained soluble up to 2 mg/ml and could be stored at −20°C. Specific rabbit antibodies against alpha purothionin were raised by immunization of a New Zealand white rabbit with purified EcTri a 37 (200 µg per injection) using once Freund's complete adjuvant and twice Freund's incomplete adjuvant. (Charles River, Kisslegg, Germany). Pre-immune serum was obtained from the rabbit before immunization.
Recombinant production of BvTri a 37
Subcloning of Tri a 37 and production of recombinant bacmid DNA.
The cDNA (364 bp) coding for Tri a 37 (accession number AFQ60540.1) containing an additional 3′ sequence coding for a hexahistidine tag was produced as synthetic gene and subcloned into the BamHI/SmaI sites of pUC57 (GenScript, NJ, USA) with codons optimized for insect cell expression. This cDNA was then cloned into the BamHI/SmaI sites of the pTM1 vector harbouring the baculoviral polyhedrin promoter sequence. [16] The plasmid containing the Tri a 37 insert was transformed into XL-1 Blue competent cells (Agilent technologies, Santa Clara, USA) and selected for ampicillin and tetracycline. The correct insertion of the cDNA was confirmed by restriction analysis of plasmid mini-prep DNA (Promega, Madison, Wisconsin, USA) with BamHI/SmaI and by sequence analysis (VBC Biotech, Vienna, Austria). Following the manual instructions (Version A, 15 December 2008) of the Bac-to-Bac TOPO Expression System (Life Technologies, Carlsbad, CA, USA), the recombinant donor plasmid containing the proper DNA sequence was transformed into competent DH10Bac E.coli cells, which allow the transposition of the DNA of interest into a baculoviral bacmid. Using blue/white selection and screening for resistance to kanamycin, tetracycline (ROTH, Karlsruhe, Germany) and gentamicin (Life Technologies, Carlsbad, CA, USA) colonies containing the Tri a 37 insert within the bacmid DNA were identified. The presence of the correct recombinant bacmid DNA containing the Tri a 37 gene was confirmed by PCR analysis. A white colony was inoculated in 100 µl water and heated for 5 min at 95°C. PCR analysis was performed using M13 primers (VBC Genomics) and GoTaq DNA polymerase (Promega, Madison, Wisconsin, USA). After midi-prep (Promega) of a positive overnight culture, occurrence of the correct DNA insert was again confirmed by PCR.
Production of recombinant baculovirus, determination of viral titer.
Recombinant baculovirus was produced using the Bac-to-Bac insect cell expression system (Life Technologies). The recombinant bacmid DNA containing the Tri a 37 DNA was transfected into Sf9 insect cells (Life Technologies) in order to produce recombinant baculovirus. Sf9 insect cells were grown in Sf-900 II SFM media (Life Technologies) supplemented with 10 µg/ml gentamicin (Life Technologies), 2.5% Fetal Bovine Serum (Life Technologies) and maintained in the log phase (3×105–3×106 cells/ml) at 27°C for the entire experiment. For transfection, a total of 2×106 Sf9 insect cells in 2 ml media per well were seeded in a 6-well-plate and incubated for 30 min at 27°C for cell attachment. After replacing the medium containing gentamicin and fetal bovine serum with medium, 100 µl transfection cocktail consisting of 6 µl transfection reagent (FuGENE HD Transfection Reagent, Promega, Madison), 2 µg recombinant bacmid DNA, H2O ad 100 ∘l were added to each well. After 7hrs, the medium was removed, replaced with fresh medium containing gentamicin and FBS and incubated for 72hrs at 27°C. Baculoviral stock (P1 viral stock) was collected from the supernatant after centrifugation at 750 xrpm for 5 min at room temperature and stored at 4°C in the dark until use. To determine the viral titre, a plaque assay was performed seeding 2 ml of Sf9 cells (1×106 Sf9 cells/well) in 6-well-plates for 1 hour. After removing medium from the cells, attached insect cells were infected with 1 ml/well of serial viral dilutions (P1: 104, 105, 106; P2 and P3: 105, 106, 107, 108), using 1xDPBS (Life Technologies, Carlsbad, CA, USA), for 1 hour at room temperature. The supernatant was removed and infected insect cells were covered with 2 ml of Sf-900 medium 1.3X (Life Technologies) containing 1% low-melting agarose and 10 µg/ml of gentamicin. Plates were kept, without moving, for 1 hour at room temperature allowing the agarose mixture to solidify. After wrapping the plate in moisturized paper, the plate was covered with aluminium foil and incubated for 5–7 days at 27°C. Plaques were stained with 2 ml of neutral red solution (Sigma Aldrich, Munich, Germany), diluted 1∶10 in 1xPBS for 2 hours at room temperature. After removal of the staining solution, plaques became visible and were counted. For further amplification of P1 stock to generate a high-titer P2 stock, the following formula was used: inoculum required (ml) = [MOI (pfu/cell) x number of cells]/titer of viral stock (pfu/ml). Ten ml of cells (2×106 cells/ml → 2×107 cells) were infected with 2 ml of P1 stock (1×106 pfu/ml) to obtain a MOI (multiplicity of infection: number of virus particles per cell) of 0.1. The viral titer of P2 stock was again determined by plaque assay and stored as described above for P1 viral stock.
In optimization experiments, several conditions (MOI 1, 2, 3, 4; durations of expression 24hrs, 48hrs, 72hrs, 96hrs) were tested to optimize the protocol. Samples were taken, centrifuged at 10,000 rpm for 2 min, sample buffer was added to the supernatants and stored at 4°C. All collected samples were subjected to 14% SDS-PAGE, blotted onto nitrocellulose and tested with Tri a 37-specific rabbit antibodies to detect the level of BvTri a 37 expression.
Expression of BvTri a 37.
For expression of BvTri a 37, 200 ml of 2×106 cells/ml Sf9 cells present in fresh Sf-900 II SFM medium (+Gm, -FBS) were infected with the viral P2 stock to reach MOI = 1 for 96hrs while shaking at 80 rpm/min at 27°C in the dark. After centrifugation at 750 xrpm for 15 min, PMSF (10 µg/ml) were added to secreted protein-containing supernatants. For protein purification under native conditions, using nickel affinity chromatography (Qiagen), supernatants were dialyzed against lysis buffer (50 mM NaH2PO4, 300 mM NaCl, 1 mM Imidazole, pH 8.0) o/N, and incubated with pre-equilibrated nickel agarose in a batch procedure o/N. The agarose batch was filled into column, washed with wash buffer (50 mM NaH2PO4, 300 mM NaCl, 20 mM Imidazole, pH 8.0) and eluted with elution buffer (50 mM NaH2PO4, 300 mM NaCl, 250 mM Imidazole, PH 8.0). BvTri a 37-containing fractions were pooled and dialyzed against 10 mM NaH2PO4 pH 8.0 and stored at −20°C.
Characterization of recombinant proteins
The protein concentrations of both recombinant allergens were determined in parallel by BCA assay (Pierce, Rockford, IL) and purity was assessed by Coomassie Blue-stained 14% SDS–PAGE. The protein was analysed under reducing and non-reducing conditions. [17] Nitrocellulose-blotted, recombinant EcTri a 37 and BvTri a 37 (2 µg each) were tested with serum (dilution 1∶10) from a wheat food allergic patient (Patient 1, Table 1) and buffer as a control. Bound IgE antibodies were detected with 125I-labeled anti-human IgE antibodies (Demeditec Diagnostics, Kiel, Germany) and visualized by autoradiography. Aqueous wheat seed extract (20 µg) was blotted and probed with Tri a 37-specific rabbit antibodies and for control purposes with the corresponding pre-immune serum (dilution 1∶10.000). Bound IgG antibodies were detected with 125I-labeled goat anti-rabbit IgG antibodies (Perkin Elmer, Boston, USA) and visualized by autoradiography. The identity of the recombinant proteins was confirmed by mass spectrometry (Bruker, Billerica, MA). [18] Mass spectrometry, size exclusion chromatography and circular dichroism measurement (CD) were performed as previously described. [18] For the chemical crosslinking of oligomers in solution 2 ng of EcTri a 37 or BvTri a 37 were incubated in a total volume of 15 µl with 0.01–0.2% v/v glutaraldehyde for 15 minutes at room temperature. To generate samples in a reduced condition 10 mM DTT was added 10 minutes prior to the glutaraldehyde. The reaction was stopped by adding 2 µl of a 1 M glycine solution. The resulting products were assessed by 18% SDS-PAGE and by size exclusion chromatography. [18]
Tri a 37 was analyzed using the Expasy ProtScale accessibility program for the presence of surface-exposed areas. [19]
Sera from wheat allergic patients used for testing the IgE reactivity of the allergens
Sera were obtained from European wheat food allergic patients (Austria n = 1; Finland: n = 3; Greece: n = 6; total: n = 10) aged 3–41 years (mean age 12 years). Patients were diagnosed on the basis of a case history demonstrating that allergic symptoms (airway symptoms, gastrointestinal symptoms, skin symptoms, systemic anaphylaxis) were unambiguously related to the ingestion of wheat or wheat-containing products. A grading of symptoms and definition of anaphylaxis was performed according to the international position paper and recommendations for the definition of anaphylaxis (Table 1). [20] In six of the patients, open food challenge was performed and positive challenge results were obtained. Skin prick tests with wheat seed extract were performed and positive in each of the wheat allergic patients. For each patient IgE-mediated sensitization to wheat was confirmed by measurements of allergen-specific IgE (CAP-FEIA, Thermofisher, Uppsala, Sweden). Patients were further characterized for their reactivity to the two major wheat food allergens omega-5-gliadin (Tri a 19) and LMW glutenin (Tri a 36). [21]
Ethical Considerations
Serum samples were obtained in the course of routine allergy diagnosis with permission of the Helsinki University Hospital Review Board/Section for Pediatrics (Dnro 374/E7/2004), Regional Committee of Ethics of the Kopodistrian University of Athens (289/2007) and the Ethics Committee of the Medical University of Vienna (565/2007). Written informed consent was obtained from adult patients and in case of children, from their parents. A retrospective analysis of allergen-specific IgE antibodies was performed with anonymized serum samples with permission of the Ethics Committee of the Medical University of Vienna.
Determination of IgE-reactivity by dot-blotting
IgE-reactivity of EcTri a 37, BvTri a 37 and five peptides (P1–P5) was tested by by non-denaturing, RAST-based IgE dot blotting. [15] For dot blotting, aliquots of aqueous wheat seed extract (2 µg/dot), HSA (0.5 µg/dot), recombinant EcTri a 37, BvTri a 37 and peptides (0.5 µg/dot) were dotted onto nitrocellulose strips (Schleicher & Schuell, Dassel, Germany). Strips were incubated with 1∶10 diluted sera of allergic patients sera (1–10) or with 1∶10,000 diluted EcTri a 37-specific rabbit antibodies. As a control, serum of a non-atopic individual (N), rabbit pre-immune serum or buffer (B) alone were included. Bound IgE antibodies were detected with 125I-labeled anti-human IgE antibodies (Demeditec Diagnostics, Kiel, Germany), bound rabbit antibodies with 125I-labeled anti-rabbit IgG antibodies (Perkin Elmer, Waltham, USA) and visualized by autoradiography. [22]
Synthesis, characterization and antibody reactivity of Tri a 37 peptides
Five 10aa- overlapping peptides spanning the Tri a 37 sequence (Table 2; accession number AFQ60540.1) were synthesized (Microwave peptide synthesizer liberty CEM GmbH, Germany) using a Fmoc (9-fluorenylmethoxycarbonyl)-strategy with HBTU [2-(1H-Benzotriazol-1-yl)1,1,3,3 tetramethyluronium hexafluorophosphat] activation as described by Focke et al. [23] Table 2 shows the amino acid sequences of Tri a 37-derived peptides. Four of the five peptides had a length of 30 amino acids whereas peptide 4 was synthesized without C-terminal cysteine and hence only 29 aa long. After purification by HPLC to a purity >90%, the identities of the peptides were confirmed by mass spectrometry.
Inhibition of allergic patients' IgE-binding to EcTri a 37 by rabbit IgG antibodies as determined by ELISA inhibition assay
ELISA plates (Nunc-Immuno Plate, Maxisorp, Thermofisher Scientific, Denmark) were coated with EcTri a 37 diluted in PBS (c = 2 µg/ml) overnight at 4°C. After washing plates twice with PBST and blocking with blocking buffer (PBST, 1% [w/v] BSA) for 2 hours at room temperature, plates were incubated overnight at 4°C with rabbit anti-EcTri a 37 immune-serum or the corresponding pre-immune serum which had been diluted 1∶50 in PBST, 0.5% (w/v) BSA. After washing, plates were incubated with 1∶10 diluted sera from wheat food allergic patients (Table 1; Patients 1, 3, 4) overnight at 4°C and bound human IgE antibodies were detected with horseradish peroxisase (HRP)-coupled goat anti-human IgE antibodies (KPL, Gaithersburg, MD) diluted 1∶2,500 in PBST, 0.5% (w/v) BSA. The color reaction was induced by addition of 1.7 mM 2,2′-azino-di-[3-ethyl-benzthiezolin-sulfonet] (Sigma-Aldrich) in 60 mM citric acid, 77 mM Na2HPO4·2H2O and 3 mM H2O2.OD measurements were performed after 30 minutes in an ELISA reader (Spectra Max PLUS 384, Molecular Devices, Germany) at 405 nm-490 nm. The percentage of inhibition of IgE binding was calculated as follows: 100-(ODimmune/ODpre)x100, where ODimmune and ODpre represent the extinction coefficients after pre incubation with the immune serum or with the pre-immune serum, respectively.
In-vitro digestion assays
Gastric and duodenal in-vitro digestion assay with wheat seed extract was performed as described. [24], [25] Aliquots containing 10 µg undigested or digested extract were loaded on SDS-PAGE and blotted onto nitrocellulose membranes. Membranes were incubated either with rabbit Abs raised against EcTri a 37 or the corresponding pre-immune serum. Bound rabbit Abs were detected with 125I-labeled anti-rabbit IgG Abs (Perkin Elmer, Waltham, USA) and visualized by autoradiography.
Results
Expression of recombinant Tri a 37 proteins as unfolded and folded protein
rTri a 37 expressed in a prokaryotic system using E.coli cells was designated EcTri a 37, however rTri a 37 expressed in baculovirus-infected insect cells was termed BvTri a 37. Both recombinant proteins were purified by Nickel affinity chromatography and showed a similar migration behaviour in Coomassie Blue-stained SDS-PAGE under reducing conditions where they appeared as bands of approximately 18kDa which differs from their calculated molecular weights (EcTri a 37 including N-terminal methionine and C-terminal hexahistine-tag: 12.757 Da; BvTri a 37 including a D and P residue at the N-terminus and a C-terminal hexahistidine-tag: 12.838 Da) and may be explained by the high content of positively charged amino acids (Figure 1A). Under non-reducing conditions, BvTri a 37 appeared as single band of approximately 14 kDa whereas EcTri a 37 showed an additional second band of approximately 18 kDa but no high molecular weight aggregates were visible in both protein preparations (Figure 1A). Using serum IgE from a wheat food allergic patient, monomeric EcTri a 37 and BvTri a 37 were detected at approximately 18 kDa by immunoblotting. Tri a 37-specific rabbit antibodies reacted with natural, monomeric Tri a 37 at 15 kDa in a nitrocellulose-blotted aqueous wheat seed extract (Figure 1B).
(A) Coomassie brilliant blue-stained SDS-PAGE under reducing (lane R) and under non-reducing (lane NR) conditions. A protein molecular weight marker (kDa) is shown on the left side. (B) Detection of IgE-reactivitiy to Western-blotted EcTri a 37 and BvTri a 37, using serum from a wheat food allergic patient (P) and buffer (B) as a control. Western-blotted wheat seed extract was tested with Tri a 37-specific rabbit antibodies (Immune) or the corresponding pre-immune serum (Pre). Bound human IgE and rabbit IgG antibodies were detected with 125Iodine-labeled antibodies and visualized by autoradiography. Molecular weights are indicated in kilo Dalton (kDa). (C) Mass spectrometry of recombinant EcTri a 37 and BvTri a 37. The mass/charge ratios are shown on the x-axes, and the intensities are displayed on the y-axes as percentages of the most intensive signals obtained in the investigated mass range. (D) Circular dichroism analysis of recombinant EcTri a 37 and BvTri a 37. The spectra are expressed as mean residue ellipticities (θ) (y-axes) at given wavelengths (x-axes).
MALDI-ToF analysis of EcTri a 37 resulted in a mass peak of 12.742 Da corresponding to the predicted molecular weight of the monomeric protein including methionine and a hexahistidine-tag. (Figure 1C, left). Three BvTri a 37 preparations were analyzed by MALDI-ToF. For one preparation the molecular weight determined by mass spectrometry (i.e., 11.837 Da) was smaller than the calculated mass (Figure 1B, right) whereas for the two other preparations the measured masses were 12.829 Da and 12.913 Da, respectively, which fitted the calculated mass (i.e., 12.838 Da). The smaller mass of the first preparation was most likely was due to N-terminal proteolytic degradation because the His-tag was intact as shown by immunoblotting with an anti-His-tag antibody (data not shown). Chemical cross-linking experiments and size exclusion experiments showed that both, EcTri a 37 and BvTri a 37, occurred as monomeric proteins (data not shown).
The far-UV CD spectrum of EcTri a 37 indicated that the recombinant protein was unfolded which is characterized by minimum at approximately 205 nm. By contrast, BvTri a 37 appeared as folded protein showing a CD spectrum typical for a predominant α-fold with two minima at 208 and 222 nm and a maximum at approximately 190 nm (Figure 1D).
Unfolded EcTri a 37 and folded BvTri a 37 show comparable IgE-reactivity
The IgE-reactivity of both recombinant allergens EcTri a 37 and BvTri a 37 was tested in non-denaturing, RAST-based IgE-dot blot experiments with sera from 10 patients with confirmed wheat-induced food allergy (Figure 2A; Table 1). Both allergens showed very similar and specific IgE-binding capacity when tested with the sera from the five wheat allergic patients who were sensitized to Tri a 37 (patients #1–5) but not with sera from wheat allergic patients who were not sensitized to Tri a 37 (patients #6–10). Also Tri a 37-specific rabbit antibodies reacted with both recombinant allergens in a comparable manner (Figure 2A). Allergic patients' sera, but not serum from a non-allergic subject or buffer displayed IgE reactivity to wheat extract. Likewise, wheat extract was recognized by the rabbit anti-Tri a 37 antibodies but not by the pre-immune serum or buffer. The negative control protein HSA showed no reactivity (Figure 2A).
(A) Nitrocellulose-dotted wheat seed extract (WSE), human serum albumin (HSA), EcTri a 37 and BvTri a 37 were tested with sera from ten wheat food allergic patients (1–10), with serum from a non-allergic individual (N), buffer alone (B), with Tri a 37-specific rabbit antibodies (I), the corresponding rabbit pre-immune serum (P) and buffer control (B). (B) Testing of Tri a 37 peptides (P1–P5) as in (A).
Tri a 37 contains sequential IgE epitopes in the N- as well as C- terminal domain
In order to study the IgE epitopes of Tri a 37 in more detail, we tested the sera from the wheat allergic patients also for IgE reactivity with synthetic Tri a 37 peptides (Figure 2B). Five overlapping peptides spanning the Tri a 37 sequence were synthesized and purified (Figure 3, Table 2). With the exception of peptide 4 which was 29 amino acids long, the synthesized peptides were 30 amino acids long with overlaps of ten amino acids (Figure 3A). The molecular weights of the peptides range from 3095 to 3291 Dalton. Three of the synthesized peptides were from the original IgE-reactive recombinant fragment whereas peptides 1 and 2 also included portions of the N-terminal thionin domain which is rich in basic amino acids and has a pI of 9.75 whereas the C-terminal acidic extension domain is acidic (pI 3.53) (Figure 3A; Table 2). Hence, the isoelectric points of the individual peptides ranged from 3.71 to 9.69 depending on the domain from which they originated (Table 2). Peptides 1, 3 and 4 from both domains were recognized by IgE antibodies from Tri a 37-sensitized patients and also by Tri a 37-specific rabbit antibodies. Peptides 2 and 5 did not react with IgE from the tested patients and also not with rabbit IgG antibodies raised by immunization with rTri a 37 (Figure 2B). According to the prediction of surface-exposed portions of Tri a 37, the IgE-reactive peptides were derived from surface-exposed regions (e.g., peptides 3 and 4) but included also less surface-exposed areas (i.e., peptide 1) (Figure 3B).
(A) Amino acid sequence of Tri a 37 showing the N- and C-terminal domain and the originally isolated IgE-reactive fragment (underlined). Cysteins are boxed, basic and acidic amino acids are coloured in red and blue, respectively. Synthetic Tri a 37 peptides P1–P5 are indicated. (B) Surface accessibility plot of the Tri a 37 amino acid sequence. The numbers of the amino acids, the thionin domain (green), the C-terminal acidic extension domain (pink), the synthetic peptides (yellow) are indicated on the x-axis. The calculated accessibility of the residues is indicated on the y-axis. Scores above 5.5 (bold horizontal line) represent regions of high surface accessibility.
IgG antibodies induced by immunization with EcTri a 37 recognize similar epitopes as allergic patients IgE and inhibit allergic patients' IgE binding to Tri a 37
EcTri a 37- specific rabbit IgG antibodies were then used to investigate their ability to inhibit wheat food allergic patients' IgE binding (Table 1; Patient 1, 3, 4) to the allergen in ELISA competition experiments. In patients 3 and 4 who showed the strongest IgE binding to Tri a 37, rabbit anti-Tri a 37 antibodies caused a 64% and 73% inhibition of IgE binding respectively whereas the inhibition in patient 1 who showed low levels of Tri a 37-specific IgE was 39% (Figure 4).
Tri a 37 was tested for IgE reactivity with sera from three Tri a 37-allergic patients (1, 3, 4), serum from a non-allergic individual or buffer after pre-incubation with rabbit anti-Tri a 37 antibodies (Immune) or the rabbits pre-immune serum (Pre). Shown are the optical density (O.D.) levels corresponding to bound IgE.
Natural Tri a 37 in wheat extracts is digested under gastric digestion conditions
Figure 5 shows nitrocellulose-blotted wheat extracts which were subjected to gastric and duodenal digestion and then probed with rabbit anti-Tri a 37 antibodies. Undigested Tri a 37 was detected at 15 kDa whereas one minute of gastric digestion led to the loss of the signal. Under duodenal digestion conditions, Tri a 37 could be detected even after 45 minutes at 15 kDa and an additional smaller IgG binding band at 10 kDa became visible after 10 minutes of digestion (Figure 5).
Undigested wheat seed extract (undigested) or after different times of gastric (top panel) or duodenal digestion (lower panel) was subjected to SDS-PAGE and blotted to nitrocellulose. Nitrocelluloses were then tested with rabbit anti-Tri a 37 antibodies (Immune) and the corresponding pre-immune serum (Pre). Bound IgG antibodies were detected with 125I-labeled anti-rabbit IgG antibodies and visualized by autoradiography.
Discussion
Here we showed that IgE recognition of Tri a 37, a wheat food allergen which is associated with severe wheat-induced anaphylaxis does not require conformational epitopes. Using two different expression systems, an unfolded variant of rTri a 37 (i.e., EcTri a 37) was produced by prokaryotic expression and a folded form was obtained by expression in baculovirus-infected insect cells (i.e., BvTri a 37). The differences in fold between the two recombinant proteins were not due to differences in glycosylation because Tri a 37 does not contain any glycosylation sites. However, Tri a 37 contains 14 cystein residues of which 8 are known to form 4 disulphide bridges in a correctly folded N-terminal thionin domain for which the three-dimensional structure was obtained by x-ray crystallography and nuclear magnetic resonance analysis. [26], [27] Interestingly, both, the folded as well as the unfolded Tri a 37 occurred as monomeric proteins in SDS-PAGE under non-reducing conditions and when analyzed by size exclusion chromatography indicating that in both proteins the 14 cysteins were mainly engaged in the formation of intra-molecular but did not form inter-molecular disulphide bonds. The presence and lack of structural fold in the two proteins therefore may be attributed to correct versus partly incorrect formation of intra-molecular disulphide bonds. Comparable IgE binding capacity of EcTri a 37 and BvTri a 37 in non-denaturing, RAST-based IgE binding assay revealed that wheat food allergic patients' IgE recognition does not require structural fold of Tri a 37. A more detailed analysis of IgE epitopes was performed with 5 synthetic peptides spanning the complete Tri a 37 sequence which had an overlap of 9–10 amino acids. Using these synthetic peptides, sequential IgE binding sites were found at the N-terminal thionin domain and the C-terminal extension domain. Not all Tri a 37-reactive sera reacted also with peptides which may be due to the fact that certain IgE-reactive areas were not covered by the peptides due to limited overlap or length. Nevertheless, our data demonstrate that IgE recognition of Tri a 37 thus does not require fold and is directed against sequential epitopes which is typical for class I food allergens which sensitize mainly via the gut such as other wheat food-, milk, egg and peanut allergens. When we digested natural wheat extract containing Tri a 37, we found that the allergen was digested under conditions of gastric digestion whereas it was stable under conditions of duodenal digestion. This finding fits to the observation that Tri a 37 contains sequential epitopes which are represented by peptides. IgE recognition of sequential epitopes might thus be explained by sensitization to proteolytic fragments of Tri a 37. In this context it is tempting to speculate that sensitization to Tri a 37 and symptoms caused by Tri a 37 may be modulated by conditions affecting gastric digestion such as pathologies of the gastrointestinal tract and low acidic conditions which may occur in in children or elderly persons or as consequence of antacid medication. [28], [29]
Currently several approaches of allergen-specific immunotherapy are pursued for food allergies, among them oral, sublingual and epicutaneous immunotherapy with natural food allergens [30] and also injection immunotherapy approaches using recombinant food allergens. [31] In this context, we investigated the ability of rabbit IgG antibodies which were induced by immunization with recombinant Tri a 37, to inhibit allergic patients IgE binding to Tri a 37. In fact, we found that Tri a 37-specific IgG inhibited allergic patients IgE binding to Tri a 37 indicating that it may be possible to perform injection immunotherapy with recombinant Tri a 37 with the goal to induce blocking IgG antibodies which are known to play a major role in immunotherapy.
In conclusion we showed that IgE epitopes of Tri a 37 are of the non-conformational type, including sequential epitopes and that rTri a 37 expressed in E.coli as well as insect cells can be used for the serological detection of Tri a 37-specific IgE in diagnostic tests. Furthermore, it may be possible to use rTri a 37 for immunotherapy in sensitized individuals.
Author Contributions
Conceived and designed the experiments: SP RV. Performed the experiments: SP MW MFT GH AD. Analyzed the data: SP RV WK VN SV. Contributed reagents/materials/analysis tools: RS NGP SG MM AP. Wrote the paper: SP RV.
References
- 1. Cordain L (1999) Cereal grains: humanity's double-edged sword. World Rev Nutr Diet 84 p 19–73.
- 2. Helm RM, Burks AW (2008) Food allergens. Clin Allergy Immunol 21 p. 219–35.
- 3. Pourpak Z, Mansouri M, Mesdaghi M, Kazemnejad A, Farhoudi A (2004) Wheat allergy: clinical and laboratory findings. Int Arch Allergy Immunol 133(2) p 168–73.
- 4. Asero R, Antonicelli L, Arena A, Bommarito L, Caruso B (2009) Causes of food-induced anaphylaxis in Italian adults: a multi-centre study. Int Arch Allergy Immunol 150(3) p 271–7.
- 5. Matsuo H, Kohno K, Morita E (2005) Molecular cloning, recombinant expression and IgE-binding epitope of omega-5 gliadin, a major allergen in wheat-dependent exercise-induced anaphylaxis. FEBS J 272(17) p 4431–8.
- 6. Hofmann SC, Fischer J, Eriksson C, Bengtsson GO, Biedermann T, et al. (2012) IgE detection to alpha/beta/gamma-gliadin and its clinical relevance in wheat-dependent exercise-induced anaphylaxis. Allergy 67(11) p 1457–60.
- 7. Matsuo H, Kohno K, Niihara H, Morita E (2005) Specific IgE determination to epitope peptides of omega-5 gliadin and high molecular weight glutenin subunit is a useful tool for diagnosis of wheat-dependent exercise-induced anaphylaxis. J Immunol 175(12) p 8116–22.
- 8. Palacin A, Bartra J, Muñoz R, Diaz-Perales A, Valero A, et al. (2010) Anaphylaxis to wheat flour-derived foodstuffs and the lipid transfer protein syndrome: a potential role of wheat lipid transfer protein Tri a 14. Int Arch Allergy Immunol 152(2) p 178–83.
- 9. Pahr S, Constantin C, Papadopoulos NG, Giavi S, Mäkelä M, et al. (2013) alpha-Purothionin, a new wheat allergen associated with severe allergy. J Allergy Clin Immunol 132(4): 1000e1 –
- 10. Reese G, Ayuso R, Leong-Kee SM, Plante MJ, Lehrer SB (2001) Characterization and identification of allergen epitopes: recombinant peptide libraries and synthetic, overlapping peptides. J Chromatogr B Biomed Sci Appl 756(1–2) p 157–63.
- 11.
Nowak-Wegrzyn A (2007) Food allergy to proteins. Nestle Nutr Inst Workshop Ser 59 : p. 17–31; discussion 31––6.
- 12.
Battais F, Mothes T, Moneret-Vautrin DA, Pineau F, Kanny G, et al.. (2005) Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat. Allergy 60(6) : p. 815–21.
- 13. Roth-Walter F, Starkl P, Zuberbier T, Hummel K, Nöbauer K, et al. (2013) Glutathione exposes sequential IgE-epitopes in ovomucoid relevant in persistent egg allergy. Mol Nutr Food Res 57(3) p 536–44.
- 14. Vila L, Beyer K, Järvinen KM, Chatchatee P, Bardina L, et al. (2001) Role of conformational and linear epitopes in the achievement of tolerance in cow's milk allergy. Clin Exp Allergy, 2001. 31(10) p 1599–606.
- 15. Pahr S, Constantin C, Mari A, Scheiblhofer S, Thalhamer J, et al. (2012) Molecular characterization of wheat allergens specifically recognized by patients suffering from wheat-induced respiratory allergy. Clin Exp Allergy 42(4) p 597–609.
- 16.
Marlovits TC, Zechmeister T, Schwihla H, Ronacher B, Blaas D (1998) Recombinant soluble low-density lipoprotein receptor fragment inhibits common cold infection. J Mol Recognit 11(1–6) : p. 49-51.
- 17. Chen KW, Blatt K, Thomas WR, Swoboda I, Valent P, et al. (2012) Hypoallergenic Der p 1/Der p 2 combination vaccines for immunotherapy of house dust mite allergy. J Allergy Clin Immunol 130(2) p 435–43 e4.
- 18. Campana R, Vrtala S, Maderegger B, Dall'Antonia Y, Zafred D, et al. (2011) Altered IgE epitope presentation: A model for hypoallergenic activity revealed for Bet v 1 trimer. Mol Immunol 48(4) p 431–41.
- 19. Janin J (1979) Surface and inside volumes in globular proteins. Nature 277(5696) p 491–2.
- 20. Sampson HA, Muñoz-Furlong A, Campbell RL, Adkinson NF Jr, Bock SA, et al. (2006) Second symposium on the definition and management of anaphylaxis: summary report—second National Institute of Allergy and Infectious Disease/Food Allergy and Anaphylaxis Network symposium. Annals of emergency medicine 47(4) p 373–80.
- 21. Baar A, Pahr S, Constantin C, Giavi S, Manoussaki A, et al. (2014) Specific IgE reactivity to Tri a 36 in children with wheat food allergy. J Allergy Clin Immunol 133(2) p 585–7.
- 22. Valenta R, Duchene M, Ebner C, Valent P, Sillaber C, et al. (1992) Profilins constitute a novel family of functional plant pan-allergens. J Exp Med 175(2) p 377–85.
- 23. Focke M, Mahler V, Ball T, Sperr WR, Majlesi Y, et al. (2001) Nonanaphylactic synthetic peptides derived from B cell epitopes of the major grass pollen allergen, Phl p 1, for allergy vaccination. FASEB J 15(11) p 2042–4.
- 24. Baar A, Pahr S, Constantin C, Scheiblhofer S, Thalhamer J, et al. (2012) Molecular and immunological characterization of Tri a 36, a low molecular weight glutenin, as a novel major wheat food allergen. J Immunol 189(6) p 3018–25.
- 25. Vieths S, Reindl J, Müller U, Hoffmann A, Haustein D (1999) Digestibility of peanut and hazelnut allergens investigated by a simple in vitro procedure. Eur Food Res Technol 209(6) p 379–388.
- 26. Teeter MM, Ma XQ, Rao U, Whitlow M (1990) Crystal structure of a protein-toxin alpha 1-purothionin at 2.5A and a comparison with predicted models. Proteins 8(2) p 118–32.
- 27. Clore GM, Nilges M, Sukumaran DK, Brünger AT, Karplus M, et al. (1986) The three-dimensional structure of alpha1-purothionin in solution: combined use of nuclear magnetic resonance, distance geometry and restrained molecular dynamics. EMBO J 5(10) p 2729–35.
- 28. Untersmayr E, Jensen-Jarolim E (2008) The role of protein digestibility and antacids on food allergy outcomes. J Allergy Clin Immunol 121(6) p. 10–8 quiz –
- 29. Untersmayr E, Schöll I, Swoboda I, Beil WJ, Förster-Waldl E, et al. (2003) Antacid medication inhibits digestion of dietary proteins and causes food allergy: a fish allergy model in BALB/c mice. J Allergy Clin Immunol 112(3) p 616–23.
- 30. Jones SM, Burks AW, Dupont C (2014) State of the art on food allergen immunotherapy: Oral, sublingual, and epicutaneous. J Allergy Clin Immunol 133(2) p 318–23.
- 31.
Zuidmeer-Jongejan L, Fernandez-Rivas M, Poulsen LK, Neubauer A, Asturias J, et al.. (2012) FAST: towards safe and effective subcutaneous immunotherapy of persistent life-threatening food allergies. Clin Transl Allergy 2(1) : p. 5.