Complete output

Complete outputComplete output

Protein Group 1

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
2033	98	38	30	37

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
330	1051.42	2100.83	2100.04	67	ALASQALSIFGDHQDVMAAR	37Rep_8
383	706.53	2116.57	2116.04	37	ALASQALSIFGDHQDVMAAR +Oxidation (M)	37RepA_1
271	892.12	1782.22	1781.83	42	ATYLIDEADYIACHK	37Rep_8
172	767.05	1532.08	1531.75	62	EPGSTGEPLYLDVR	37RepA_8
1	403.43	804.85	804.41	38	FGDTPIR	37RepA_8
42	471.39	940.76	940.50	32	FYTVNAVK	37RepA_8
383	1335.93	2669.84	2669.17	32	GPSWANSLFEDNAEYGFGMYTAVK +Oxidation (M)	37RepA_8
169	756.03	1510.04	1509.72	53	GTAQNPDIYFQTR	37RepA_8
150	702.02	1402.03	1401.67	36	HFLDAMPSTVER	37RepA_8
155	709.96	1417.90	1417.67	34	HFLDAMPSTVER +Oxidation (M)	37RepA_8
170	758.56	1515.11	1514.67	81	HSLFDYYGAEDAK	37RepA_8
419	779.53	2335.56	2335.01	61	IQVSPLDCTGCGNCADICPAK	37RepA_1
322	1036.79	2071.57	2070.92	58	IVDAMTELVSMDICEDAK +2 Oxidation (M)	37Rep_8
320	1028.79	2055.57	2054.92	66	IVDAMTELVSMDICEDAK +Oxidation (M)	37Rep_8
292	938.75	1875.48	1874.99	106	IVNMNYAAVDAGINALVK	37Rep_8
351	946.72	1891.43	1890.99	66	IVNMNYAAVDAGINALVK +Oxidation (M)	37RepA_1
243	822.63	1643.24	1642.76	82	KHSLFDYYGAEDAK	37Rep_8
193	663.98	1325.94	1325.71	34	LAEIIPEEDAVK	37RepA_1
73	528.92	1055.82	1055.57	53	LGQEIGLGNR	37Rep_7
193	698.50	1394.98	1394.71	52	LPFIHFFDGFR	37Rep_8
408	1202.86	2403.71	2403.22	44	NGFTVGIVDDVTNTSLTPSEPIK	37Rep_8
475	1310.65	3928.93	3927.84	46	NILRPMTAQEGNNLPVSTFNGIEDGTFPCGTAAYEK +Oxidation (M)	37RepA_8
57	461.33	920.65	920.46	46	NPFTLDSK	37Rep_8
252	841.71	1681.41	1680.84	48	NPFTLDSKEPTASFK	37Rep_8
351	1095.25	2188.48	2188.96	42	QPLMEFSGACAGCGETAYIK	37Rep_8
353	1103.81	2205.61	2204.95	50	QPLMEFSGACAGCGETAYIK +Oxidation (M)	37Rep_8
59	529.86	1057.70	1057.53	68	SGGITMSHLR	37RepA_8
265	588.14	1761.41	1760.89	72	TKEPGSTGEPLYLDVR	37Rep_7
270	1055.40	2108.78	2107.99	49	TVANEAQAVACGYWHLYR	37RepA_8
213	688.43	1374.85	1375.70	39	TVFDNLVSEQPK	37RepA_1
77	545.39	1088.77	1088.55	43	VDVMPANTVK +Oxidation (M)	37Rep_7
373	857.67	2569.99	2569.27	60	VELLENEDYASLLNFEAVQAFR	37RepA_8
188	815.59	1629.16	1628.77	58	VEVPASWENAVDADK	37RepA_8
300	953.67	1905.32	1904.89	41	VVELLEKPACDCTDEK	37Rep_8
104	525.84	1049.66	1049.55	49	VVTQLYGDR	37RepA_1
490	685.95	1369.89	1369.58	71	YAQAYFDYDSK	37Rep_1
167	750.00	1497.99	1497.68	60	YAQAYFDYDSKK	37RepA_8
135	663.41	1324.81	1324.70	55	YYQNIVGIVEK	37RepA_7

Matching Genes:

gi|115251733|emb|CAJ69568.1| (pyruvate-flavodoxin oxidoreductase [Clostridium difficile 630])

Protein Group 2

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
1049	43	22	17	51

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
347	643.50	1927.49	1927.01	56	DKYPGLIFSQILGYGEK	37Rep_5
39	462.91	923.80	923.51	51	EGVEILHK	37RepA_5
193	697.98	1393.95	1393.65	28	ENPNSPLMTTYK	37Rep_5
148	705.95	1409.88	1409.65	30	ENPNSPLMTTYK +Oxidation (M)	37RepA_6
76	511.36	1020.70	1020.49	58	GGVSQSVMEK	37Rep_5
535	937.75	2810.22	2809.41	31	GTSPANTAAGFGDHYAGLALAAGSLAALHK	37RepA_5
79	549.87	1097.73	1097.57	50	IEPIEGDGIR	37Rep_7
467	1279.41	2556.81	2556.15	48	IQSCEDLLDDEQAWANDFLFK	37RepA_5
55	495.53	989.05	988.53	50	IVGEAMLEK	37RepA_5
58	503.41	1004.80	1004.52	34	IVGEAMLEK +Oxidation (M)	37RepA_5
197	739.12	1476.22	1475.80	53	LLSEADIFVTNVR	37RepA_5
62	519.99	1037.97	1037.52	56	MGIAYDQIK	37RepA_5
66	527.97	1053.93	1053.52	43	MGIAYDQIK +Oxidation (M)	37RepA_5
94	609.99	1217.96	1217.61	41	MLGDWGAEVIK	37RepA_5
119	617.97	1233.93	1233.61	30	MLGDWGAEVIK +Oxidation (M)	37Rep_5
362	997.69	1993.36	1992.84	73	SPASDDENPMFELENGNK	37Rep_5
340	1005.68	2009.34	2008.83	46	SPASDDENPMFELENGNK +Oxidation (M)	37RepA_5
393	1061.78	2121.55	2120.93	57	SPASDDENPMFELENGNKK	37Rep_5
403	1069.72	2137.42	2136.93	50	SPASDDENPMFELENGNKK +Oxidation (M)	37Rep_5
359	702.86	2105.55	2105.02	66	TLDEWSALLEEADLPFEK	37RepA_5
89	555.49	1108.96	1108.62	41	VGQHTVEVLK	37Rep_5
190	695.56	1389.11	1388.78	57	WIQLALIQYNK	37Rep_5

Matching Genes:

gi|115249401|emb|CAJ67216.1| (isocaprenoyl-CoA:2-hydroxyisocaproate CoA-transferase [Clostridium difficile 630])

Protein Group 3

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
984	42	18	14	41

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
322	680.66	2038.96	2038.93	84	AAQEQQAAQGAEQAQDNGPK	37RepA_7
506	1053.76	3158.24	3157.42	62	AAQEQQAAQGAEQAQDNGPKDDNVVDADFK	37RepA_7
270	927.17	1852.32	1851.80	57	DDNVVDADFKEVDEDK	37RepA_7
160	681.51	1361.01	1360.65	53	DNQDATAEELKK	37Rep_7
342	1065.17	2128.34	2128.03	71	EKIEAFNQAESTIYQTEK	37RepA_7
449	1204.95	2407.88	2407.19	53	ELSSTMSSNINLPFITATAEGPK	37Rep_7
120	643.34	1284.67	1284.68	51	FQLTDIPPAQR	37RepA_7
55	484.37	966.73	966.52	47	HLNIDLSR	37Rep_7
285	936.82	1871.63	1870.89	26	IEAFNQAESTIYQTEK	37RepA_4
248	847.67	1693.32	1692.84	52	IINEPTAAALAYGMDK +Oxidation (M)	37RepA_7
50	477.89	953.77	953.55	30	IPAVQEAVK	37Rep_7
107	412.29	1233.85	1233.61	28	ISSGEKEDIEK	37Rep_7
290	946.32	1890.62	1889.96	83	ITITSNTNLSEAEIEQK	37RepA_7
540	978.51	2932.49	2931.41	62	SDAESYLGQTVTEAVITVPAYFTDAQR	37Rep_7
475	834.30	2499.89	2499.24	77	SQIFSTAADNQTAVDIHVLQGER	37Rep_7
228	796.13	1590.24	1589.87	38	SYTPQEISAIILQK	37Rep_7
433	1187.86	2373.71	2373.20	57	TALQDAGLSTGDIDDVLLVGGSTR	37Rep_7
38	445.34	888.66	888.46	53	TLNELGDK	37Rep_7

Matching Genes:

gi|115251515|emb|CAJ69348.1| (chaperone protein [Clostridium difficile 630])

Protein Group 4

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
962	31	20	15	34

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
372	1086.32	2170.62	2170.04	53	ATYTMIFDHYEQVPASVAK	37Rep_7
358	1094.17	2186.32	2186.04	42	ATYTMIFDHYEQVPASVAK +Oxidation (M)	37RepA_7
157	682.00	1361.99	1361.74	59	EDSFIGIIDLLK	37RepA_7
157	679.44	1356.87	1356.64	40	GGVEPQSENVWR	37Rep_7
109	626.19	1250.36	1249.67	41	GNAVLLEPYFK	37RepA_7
221	783.09	1564.17	1563.72	50	HSSDEEPFSALAFK	37Rep_7
350	713.36	2137.06	2136.87	33	IGETHEGASQMDWMEQEK +2 Oxidation (M)	37RepA_7
456	808.54	2422.59	2422.02	33	IGETHEGASQMDWMEQEKER +2 Oxidation (M)	37Rep_7
447	803.26	2406.76	2406.02	30	IGETHEGASQMDWMEQEKER +Oxidation (M)	37Rep_7
94	604.29	1206.57	1206.64	30	ILFYTGQTHK	37RepA_7
344	685.48	2053.42	2053.05	39	INIIDTPGHVDFTVEVER	37Rep_7
116	625.45	1248.88	1248.62	67	LAEEDPTFTVK	37Rep_7
199	749.64	1497.27	1496.80	51	LNSNAVPMQLPIGK +Oxidation (M)	37RepA_7
262	878.63	1755.24	1754.80	65	LVESVAETDEELMMK +2 Oxidation (M)	37Rep_7
65	510.86	1019.71	1019.50	48	QAETYGVPR	37RepA_7
476	1251.97	2501.93	2501.23	65	SGAQVINAFVPLSEMFGYSTDLR	37Rep_7
87	587.88	1173.75	1173.57	42	VAPQEPGEGYK	37RepA_7
51	480.86	959.70	959.52	45	VGAPQVAYR	37Rep_7
115	624.56	1247.10	1246.69	60	VYAGDIAAAVGLK	37Rep_7
258	895.26	1788.51	1787.89	69	VYSGTLESGSYVLNATK	37RepA_7

Matching Genes:

gi|115249074|emb|CAJ66885.1| (translation elongation factor G [Clostridium difficile 630])

Protein Group 5

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
937	48	18	13	41

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
71	498.28	994.55	994.52	62	AEAHIQAGAK	37Rep_5
85	505.93	1009.84	1009.65	58	AIGLVIPSLK	37Rep_4
122	619.89	1237.77	1237.64	53	DKAEAHIQAGAK	37Rep_5
180	718.16	1434.31	1433.74	93	FEVVAINDLTDAK	37RepA_5
472	1212.34	2422.66	2423.15	25	GLMTTIHAYTNDQNTLDGPHPK	37Rep_5
511	814.35	2440.03	2439.15	48	GLMTTIHAYTNDQNTLDGPHPK +Oxidation (M)	37Rep_4
180	650.00	1297.99	1297.76	71	KVVISAPATGDLK	37Rep_4
33	430.31	858.60	858.48	37	MLAHLFK	37Rep_4
19	438.38	874.74	874.47	34	MLAHLFK +Oxidation (M)	37RepA_5
452	1163.36	2324.70	2324.10	58	MMEQQDKFEVVAINDLTDAK	37Rep_5
436	1179.45	2356.88	2356.09	59	MMEQQDKFEVVAINDLTDAK +2 Oxidation (M)	37RepA_5
449	1171.41	2340.80	2340.10	33	MMEQQDKFEVVAINDLTDAK +Oxidation (M)	37Rep_6
104	556.47	1110.93	1110.61	45	TLGYFAQLAK	37Rep_4
124	589.92	1177.82	1177.63	30	VLNDKYGIEK	37Rep_4
483	887.17	1772.33	1771.98	54	VPVVTGSITELVCTLGK	37Rep_2
123	585.96	1169.90	1169.67	60	VVISAPATGDLK	37Rep_4
308	1046.30	2090.59	2089.98	43	VVSWYDNEMSYTSQLIR	37RepA_6
424	1054.34	2106.66	2105.97	74	VVSWYDNEMSYTSQLIR +Oxidation (M)	37Rep_4

Matching Genes:

gi|115252231|emb|CAJ70071.1| (glyceraldehyde-3-phosphate dehydrogenase 2 [Clostridium difficile 630])

Protein Group 6

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
778	23	14	11	20

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
163	688.59	1375.17	1374.78	35	FQSLLVAIEDLK	37RepA_7
318	1011.09	2020.17	2019.92	44	HTTFFEVEPDPTLECAK	37RepA_7
178	714.98	1427.95	1427.69	59	IFATYSQEQVDK	37Rep_7
79	560.08	1118.14	1117.65	73	IFLAASLAANK	37RepA_7
337	1019.26	2036.51	2036.06	51	ILINTPSSQGGIGDLYNFK	37Rep_7
85	581.34	1160.67	1160.62	82	IVGQTACTIAK	37RepA_7
418	1161.82	2321.62	2321.09	63	LVEDGGFGHTSSLYIDDVNQR	37Rep_7
242	818.62	1635.23	1634.74	66	NHYASEYIYNAYK	37Rep_7
67	512.93	1023.84	1023.54	34	SIFEYLPR	37Rep_7
66	516.32	1030.62	1030.60	71	TAVNSILVSK	37RepA_7
388	710.19	2127.56	2127.07	53	VLIGEVESVEIEEAFAHEK	37RepA_1
54	485.90	969.79	969.57	44	VPLAIMAQK	37RepA_7
61	493.90	985.78	985.56	33	VPLAIMAQK +Oxidation (M)	37Rep_7
88	570.49	1138.96	1138.64	70	YAGIASFLGLK	37Rep_7

Matching Genes:

gi|115252023|emb|CAJ69859.1| (aldehyde-alcohol dehydrogenase [includes: alcohol dehydrogenase and pyruvate-formate-lyase deactivase [Clostridium difficile 630])

Protein Group 7

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
762	40	15	14	40

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
528	1270.92	2539.82	2539.30	72	AYEGGFAIGAFNISDLEQLQGVLK	37Rep_4
197	530.36	1058.70	1058.56	55	DAIQAVVESK	37Rep_2
89	611.50	1220.99	1220.63	56	FDILEEIQSK	37RepA_4
26	409.76	817.50	817.43	41	FLAENPK	37Rep_1
46	489.37	976.73	976.46	52	INMDTDLR	37RepA_4
236	497.24	992.46	992.46	41	INMDTDLR +Oxidation (M)	37Rep_1
69	473.87	945.72	945.53	50	KFLAENPK	37Rep_4
25	423.83	845.64	845.48	47	LAMTAAIR	37Rep_4
44	431.79	861.57	861.47	39	LAMTAAIR +Oxidation (M)	37RepA_1
261	781.01	1560.01	1559.73	51	NSYVMIQASMSAVK +2 Oxidation (M)	37Rep_4
189	773.11	1544.21	1543.74	43	NSYVMIQASMSAVK +Oxidation (M)	37RepA_4
249	873.31	1744.60	1743.92	56	TGVDSLAIAIGTSHGAFK	37RepA_4
152	672.99	1343.96	1343.69	43	YAGPHTLVEMVK	37RepA_4
211	680.97	1359.93	1359.69	44	YAGPHTLVEMVK +Oxidation (M)	37Rep_4
367	770.02	1538.02	1537.74	72	YTQPAEAVEFVER	37Rep_3

Matching Genes:

gi|115249409|emb|CAJ67224.1| (putative fructose-bisphosphate aldolase [Clostridium difficile 630])

Protein Group 8

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
748	32	17	11	41

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
272	880.24	1758.47	1757.88	60	ALQSGTSHFLGQHFTK	37Rep_6
125	668.95	1335.88	1335.62	50	DIENNQAMVFR	37RepA_6
132	677.01	1352.01	1351.62	48	DIENNQAMVFR +Oxidation (M)	37RepA_6
78	548.86	1095.70	1095.49	32	EADSMVVMAK +Oxidation (M)	37Rep_6
427	1132.81	2263.61	2263.07	56	EAEHVEGFAPEVAWVTHGGNK	37Rep_6
264	858.09	1714.17	1713.72	40	EDNTSIVENMDEFR +Oxidation (M)	37Rep_6
285	914.16	1826.30	1825.82	36	EDNTSIVENMDEFRK	37Rep_6
288	931.18	1860.35	1859.86	60	EGNLANPYHTSWGASTR	37Rep_8
79	559.41	1116.80	1116.61	42	IKEETGATIR	37Rep_6
309	944.75	1887.48	1886.84	37	MEDDFPQWYTDVITK	37Rep_6
66	497.45	992.88	992.52	43	QFVEEITK	37Rep_6
97	560.95	1119.89	1119.58	63	TDLVDYAPVK	37Rep_8
209	737.41	1472.81	1472.54	40	TMWCGDAECEAK +Oxidation (M)	37Rep_6
470	1235.37	3703.09	3702.73	29	TSEFLWQEGHTLHETAEEAQEETIQQLEVYK	37RepA_8
194	714.91	1427.80	1427.61	36	TYTIEAMMHDGK +2 Oxidation (M)	37Rep_6
149	707.01	1412.01	1411.61	40	TYTIEAMMHDGK +Oxidation (M)	37RepA_6
151	709.71	1417.40	1416.91	36	VAPIQVVIVPIAAK	37RepA_6

Matching Genes:

gi|115249053|emb|CAJ66864.1| (putative dual-specificity prolyl/cysteinyl-tRNA synthetase [Clostridium difficile 630])

Protein Group 9

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
733	53	13	10	61

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
171	452.32	902.62	902.53	45	AFLGLLNR	37Rep_1
301	628.39	1254.77	1254.58	51	EGYPEVAEAYK	37Rep_2
472	942.64	1883.27	1882.86	28	ELGLDAIHDTVHEMCK +Oxidation (M)	37Rep_3
424	785.91	2354.72	2354.06	25	ELGLDAIHDTVHEMCKDEAR +Oxidation (M)	37RepA_3
350	746.06	1490.11	1489.80	105	FAELLGEVVVADTK	37Rep_3
219	615.34	1228.67	1228.53	42	GEMVWADEHR	37Rep_3
164	415.94	1244.80	1244.52	27	GEMVWADEHR +Oxidation (M)	37RepA_2
140	608.45	1214.88	1214.59	68	IAFEEAEHAAK	37RepA_2
447	820.62	1639.22	1638.89	88	IGVAQGVDAEIIEGLR	37Rep_2
219	563.34	1124.66	1124.50	67	VDAEYGATDGK	37Rep_2
227	577.29	1152.57	1152.55	62	VGADKFEEMK	37Rep_2
195	585.37	1168.72	1168.54	43	VGADKFEEMK +Oxidation (M)	37Rep_3
307	690.90	1379.78	1379.67	82	VRVDAEYGATDGK	37Rep_3

Matching Genes:

gi|115250565|emb|CAJ68389.1| (putative rubrerythrin [Clostridium difficile 630])

Protein Group 10

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
720	34	13	12	43

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
401	742.96	2225.85	2225.15	45	DAIDEIKPEIMLFGATHIGR	37RepA_5
179	716.20	1430.38	1429.75	74	EVDAELCAILLGK	37RepA_5
159	683.60	1365.19	1364.80	79	IAPVVIELLGEGR	37RepA_7
21	430.86	859.71	859.44	41	ITQDDIR	37Rep_5
143	666.06	1330.11	1329.70	70	LDSVDDLLEAIK	37RepA_5
169	701.55	1401.08	1400.74	61	LDSVDDLLEAIKA	37RepA_5
70	543.94	1085.87	1085.56	48	LEIDPEDKK	37RepA_5
16	415.81	829.62	830.46	40	LGGVVGSSR	37Rep_4
545	1006.14	3015.41	3015.60	53	NPAAPILEIADYGVVGDLHEIVPMLIEK	37Rep_7
99	581.99	1161.96	1161.59	35	NVWIFAEQR	37Rep_5
81	554.92	1107.82	1107.58	69	TGEVIALDYK	37Rep_7
31	445.93	889.84	889.51	45	TTVLETVK	37RepA_8
92	561.90	1121.79	1121.54	60	VGTGLTADCTK	37Rep_5

Matching Genes:

gi|115249407|emb|CAJ67222.1| (electron transfer flavoprotein alpha-subunit [Clostridium difficile 630])

Other Genes Matching Peptide Subset:

gi|115249822|emb|CAJ67639.1| (electron transfer flavoprotein alpha-subunit [Clostridium difficile 630])

Protein Group 11

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
705	48	12	10	57

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
171	452.32	902.62	902.53	45	AFLGLLNR	37Rep_1
228	621.39	1240.76	1240.56	54	EGYPEVGEAYK	37Rep_3
225	699.47	1396.92	1396.66	46	EGYPEVGEAYKR	37RepA_1
472	942.64	1883.27	1882.86	28	ELGLDAIHDTVHEMCK +Oxidation (M)	37Rep_3
424	785.91	2354.72	2354.06	25	ELGLDAIHDTVHEMCKDEAR +Oxidation (M)	37RepA_3
350	746.06	1490.11	1489.80	105	FAELLGEVVVADTK	37Rep_3
127	591.41	1180.80	1180.61	66	IALEEAEHAAK	37RepA_2
300	849.66	1697.30	1696.90	82	IGVAQGVDEEIIEGLR	37RepA_3
219	563.34	1124.66	1124.50	67	VDAEYGATDGK	37Rep_2
227	577.29	1152.57	1152.55	62	VGADKFEEMK	37Rep_2
195	585.37	1168.72	1168.54	43	VGADKFEEMK +Oxidation (M)	37Rep_3
307	690.90	1379.78	1379.67	82	VRVDAEYGATDGK	37Rep_3

Matching Genes:

gi|115250515|emb|CAJ68339.1| (putative ruberythrin [Clostridium difficile 630])

Protein Group 12

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
680	27	12	11	28

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
322	1024.50	2046.98	2046.08	54	AAADEIGLPLFQYLGGVNAK	37RepA_4
58	537.86	1073.71	1073.56	61	AGYTAVISHR	37RepA_6
160	665.09	1328.17	1327.76	74	EALELIVEAITK	37Rep_6
122	657.69	1313.37	1312.73	57	GIENGVANSILVK	37RepA_6
81	581.38	1160.75	1160.55	50	IEEMVGEQAR	37RepA_8
105	589.38	1176.74	1176.54	62	IEEMVGEQAR +Oxidation (M)	37Rep_8
268	860.69	1719.36	1718.88	34	LQLVGDDLFVTNTER	37Rep_6
80	559.91	1117.80	1117.56	55	MGAEVFHSLK	37Rep_6
87	567.91	1133.81	1133.55	55	MGAEVFHSLK +Oxidation (M)	37Rep_6
90	410.98	1229.93	1229.66	43	RAGYTAVISHR	37RepA_6
381	1095.24	2188.46	2188.09	93	SGETEDSTIADLAVAVNAGQIK	37Rep_6
16	418.86	835.70	835.44	42	YVLAGEGK	37Rep_6

Matching Genes:

gi|115252227|emb|CAJ70067.1| (enolase [Clostridium difficile 630])

Protein Group 13

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
676	31	13	11	39

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
639	1064.31	3189.90	3189.59	78	ALEAANMTIEDIDLVEANEAFAAQSVAVIR +Oxidation (M)	37Rep_2
504	1370.70	2739.39	2738.43	69	ANITPDMIDESLLGGVLTAGLGQNIAR	37RepA_5
302	936.81	1871.61	1871.00	47	AQAEGKFDEEIVPVVIK	37RepA_5
433	1132.30	2262.59	2262.10	51	DGTVTAGNASGINDGAAMLVVMAK	37Rep_5
448	1148.34	2294.67	2294.09	61	DGTVTAGNASGINDGAAMLVVMAK +2 Oxidation (M)	37Rep_5
442	1140.35	2278.69	2278.09	51	DGTVTAGNASGINDGAAMLVVMAK +Oxidation (M)	37Rep_5
193	738.14	1474.27	1473.69	62	EEQDELALASQNK	37RepA_5
54	458.46	914.91	914.52	33	EVVIASAAR	37Rep_5
128	644.54	1287.06	1286.71	35	FDEEIVPVVIK	37RepA_5
99	613.19	1224.37	1223.68	60	ILTTLLYEMK	37RepA_5
115	621.10	1240.18	1239.68	40	ILTTLLYEMK +Oxidation (M)	37RepA_5
94	567.41	1132.81	1132.60	49	IMGYGPVPATK	37Rep_5
117	616.40	1230.79	1230.68	40	SVSAVELGVTAAK	37Rep_5

Matching Genes:

gi|115250080|emb|CAJ67900.1| (acetyl-CoA acetyltransferase [Clostridium difficile 630])

Protein Group 14

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
662	22	13	11	27

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
508	1350.37	2698.72	2698.26	54	AEVTDVANAIYDGTDAIMLSGETAAGK +Oxidation (M)	37Rep_7
91	573.87	1145.72	1146.55	51	DGEVVTVDASR	37Rep_7
285	928.23	1854.45	1853.94	32	GDLGVEIPTEEMPIVQK	37Rep_7
252	872.00	1741.98	1741.87	68	IENQEGVENLDEILK	37RepA_7
50	484.02	966.03	965.59	47	INLPAITPK	37RepA_7
57	486.89	971.77	971.58	52	KASDVLAIR	37Rep_7
126	649.43	1296.85	1296.59	50	RTEETLDYDR	37RepA_7
211	765.61	1529.21	1528.81	52	SGDSILIDDGLVGLR	37Rep_7
87	594.42	1186.82	1186.62	62	SPIIATTNNEK	37RepA_8
132	675.01	1348.01	1347.65	57	SSVAGNTDEVIEK	37RepA_8
90	571.36	1140.72	1140.49	41	TEETLDYDR	37Rep_7
275	920.10	1838.18	1837.84	60	TGNFEDPEVFLEEGQK	37Rep_7
49	474.39	946.76	946.49	36	VSDGIMVAR	37Rep_7

Matching Genes:

gi|115252454|emb|CAJ70297.1| (pyruvate kinase [Clostridium difficile 630])

Protein Group 15

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
647	34	12	9	45

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
37	440.89	879.76	879.45	31	AFESIWK	37Rep_6
233	748.04	1494.06	1493.72	60	DVNVFEMAQSQVK	37Rep_5
276	886.24	1770.47	1769.92	42	GGIIVDPSTLSQGELER	37Rep_6
341	1011.80	2021.59	2021.03	68	IAVQGIGNVGSYTVLNCEK	37RepA_5
139	428.37	1282.08	1281.64	28	IKEEYNVTMR	37Rep_5
447	921.18	2760.50	2759.43	28	ISLEEFWASDVDIVIPAALENSITK	37RepA_2
173	682.06	1362.10	1361.73	46	LGMEPAVYELLK	37Rep_6
367	1130.96	2259.90	2259.22	69	LTGQSSIGVITGKPVEFGGSLGR	37RepA_6
379	1138.88	2275.74	2275.04	64	LVCEAANGPTTPEADEVFAER	37RepA_6
469	1285.63	2569.25	2568.11	69	SEGSYAIYNENGLDGQAMLDYMK	37RepA_5
85	611.50	1220.98	1220.65	100	TAATGFGVAVTAR	37RepA_6
64	492.47	982.92	982.61	42	VIEVSIPVK	37Rep_6

Matching Genes:

gi|115249189|emb|CAJ67001.1| (NAD-specific glutamate dehydrogenase [Clostridium difficile 630])

Protein Group 16

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
642	19	12	11	21

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
190	734.02	1466.03	1465.69	27	AGAPFAPGANPMHGR +Oxidation (M)	37Rep_7
346	1033.74	2065.47	2064.92	55	FEPITSEYLDYDEVMSK	37Rep_7
347	1041.84	2081.66	2080.92	53	FEPITSEYLDYDEVMSK +Oxidation (M)	37Rep_7
433	810.29	2427.86	2427.24	46	LPYEHAQDGISNTFSIVPAALGK	37RepA_1
277	923.70	1845.39	1844.86	74	MAESYGFDISKPATNSK	37Rep_7
290	931.74	1861.47	1860.86	55	MAESYGFDISKPATNSK +Oxidation (M)	37Rep_7
370	1074.38	2146.74	2145.92	46	MVENSCEAFGYELDPEIK +Oxidation (M)	37Rep_7
329	1043.08	2084.15	2084.08	42	NSYPTQSILTITSNVVYGK	37RepA_7
139	660.55	1319.09	1318.69	79	SGIITGLPDAYGR	37Rep_7
308	953.36	1904.71	1903.99	49	VALYGVDALIEDKNEQK	37Rep_7
326	986.69	1971.36	1970.89	65	VSIDTSSVQYENDDLMR	37Rep_7
307	994.70	1987.38	1986.88	51	VSIDTSSVQYENDDLMR +Oxidation (M)	37RepA_7

Matching Genes:

gi|115249776|emb|CAJ67593.1| (formate acetyltransferase [Clostridium difficile 630])

Protein Group 17

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
632	37	11	10	31

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
131	652.54	1303.06	1302.71	51	ALQLHGGYGFIK	37Rep_7
112	631.34	1260.66	1260.59	44	ELDTLPAEMDK	37RepA_7
67	482.89	963.77	963.50	31	GLVYDAAQK	37Rep_5
61	519.94	1037.87	1037.54	43	GTSAFIVESK	37RepA_5
64	523.91	1045.80	1045.56	63	IAMGTLEVGR	37RepA_5
83	531.89	1061.76	1061.55	70	IAMGTLEVGR +Oxidation (M)	37Rep_5
300	627.51	1879.50	1879.08	80	IGVAALALGIAQGALDEAVK	37Rep_7
213	727.01	1452.00	1451.75	76	IVSIYEGTSEVQK	37Rep_8
53	494.42	986.82	986.59	49	VQFGKPIAK	37RepA_5
151	675.46	1348.90	1348.57	54	WDGFSTGAHEDK	37RepA_5
208	761.07	1520.13	1519.72	71	YYASEIANEVAYK	37Rep_7

Matching Genes:

gi|115249405|emb|CAJ67220.1| (acyl-CoA dehydrogenase, short-chain specific [Clostridium difficile 630])

Protein Group 18

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
586	20	11	10	32

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
428	857.97	2570.88	2570.27	86	DILDILEDNNISVVADDLAQETR	37RepA_4
86	585.51	1169.00	1168.61	49	EVVENPNAAVK	37RepA_5
252	852.10	1702.19	1701.73	43	FCDPEEYDYPLVR	37RepA_5
216	763.57	1525.13	1524.73	73	IHESIEVYNEHR	37RepA_5
175	675.92	1349.83	1349.60	33	LNAMPEEVCSGK +Oxidation (M)	37Rep_5
199	493.69	1478.05	1477.69	47	LNAMPEEVCSGKK +Oxidation (M)	37RepA_5
210	722.99	1443.96	1443.74	69	MKEVVENPNAAVK +Oxidation (M)	37Rep_5
269	884.67	1767.32	1766.79	49	QWSNIEGCSLAYDPK	37RepA_5
119	629.92	1257.82	1257.58	41	TDVPAGDDALER	37RepA_5
80	565.50	1128.98	1128.68	41	VLLTGILADSK	37RepA_5
115	613.97	1225.92	1225.66	55	YISLVHPQNR	37Rep_5

Matching Genes:

gi|115249404|emb|CAJ67219.1| (subunit of oxygen-sensitive 2-hydroxyisocaproyl-CoA dehydratase [Clostridium difficile 630])

Protein Group 19

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
571	26	10	9	44

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
144	665.00	1327.99	1327.73	58	ALENVLKDDLAK	37RepA_4
126	596.46	1190.90	1190.62	38	EALEFVNEIK	37Rep_4
293	840.11	1678.20	1677.77	67	EIDMDYVVIGHSER +Oxidation (M)	37Rep_4
88	610.96	1219.91	1219.62	42	GLYGELANEVR	37RepA_4
129	652.44	1302.87	1302.60	68	IGAQNMHFEEK	37RepA_4
193	660.41	1318.80	1318.60	47	IGAQNMHFEEK +Oxidation (M)	37Rep_4
53	513.93	1025.85	1025.60	44	KPIIAGNWK	37RepA_4
272	808.58	1615.14	1614.75	64	QYFNETDETVNKK	37Rep_4
281	820.05	1638.08	1637.79	70	TATAEDANDVISYIR	37Rep_4
279	802.21	1602.40	1601.88	73	VVVAYEPIWAIGTGK	37RepA_3

Matching Genes:

gi|115252229|emb|CAJ70069.1| (triosephosphate isomerase [Clostridium difficile 630])

Protein Group 20

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
486	24	7	6	37

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
360	969.42	1936.83	1937.95	77	AFGGADTWATSNTIAAGISK	37RepA_3
332	694.54	2080.59	2080.03	74	DGVPSILNPDDANALEEALK	37RepA_4
312	871.32	1740.62	1739.87	106	QAIDGDTAQVGPQIAEK	37RepA_3
133	604.47	1206.92	1206.61	67	QLEDGYELIK	37RepA_3
57	529.40	1056.78	1056.52	38	QVPDTNEVR	37RepA_4
217	613.41	1224.81	1224.61	61	VGDYDIIFAGR	37Rep_3
114	564.46	1126.91	1126.70	63	VSTPVLLTAVK	37RepA_3

Matching Genes:

gi|115249406|emb|CAJ67221.1| (electron transfer flavoprotein beta-subunit [Clostridium difficile 630])

Protein Group 21

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
483	11	9	8	35

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
253	794.24	1586.46	1585.88	45	AADPIVVLFGATSIGR	37Rep_5
71	545.57	1089.13	1088.55	56	ATIDAGWLDK	37RepA_5
438	759.94	2276.79	2276.15	62	ENLDILYELAEIIGGEVSGSR	37Rep_5
217	772.27	1542.53	1541.87	47	ENVIQTVSLELLGK	37RepA_5
357	987.24	1972.46	1971.96	89	IHTGLTADCTGLAVAEDTK	37Rep_5
77	513.50	1024.99	1024.66	52	LVQVVQVIK	37Rep_5
53	458.37	914.72	914.49	37	NPEAPIFK	37Rep_5
166	699.17	1396.32	1395.83	48	VLPELISQLSVAK	37RepA_5
25	444.44	886.86	886.55	47	VSALLLGSK	37RepA_5

Matching Genes:

gi|115250077|emb|CAJ67897.1| (electron transfer flavoprotein alpha-subunit [Clostridium difficile 630])

Protein Group 22

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
467	19	8	6	34

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
450	905.24	1808.47	1807.91	90	AFAGADTWATSSALAGALK	37Rep_3
17	415.84	829.66	829.45	70	AGLEEAIK	37Rep_4
418	1041.38	2080.75	2080.07	33	DGVPSIINPDDKAGLEEAIK	37Rep_4
127	650.47	1298.93	1298.67	58	DIEVDPSNLGLK	37RepA_4
62	538.93	1075.85	1075.58	51	MPCLITTLK	37RepA_4
51	508.88	1015.74	1015.52	32	QVPDTTEVK	37RepA_4
249	747.02	1492.03	1491.76	60	SVKPAGTIYNEDAK	37RepA_3
65	459.37	916.73	916.52	73	TSAGIIIDK	37Rep_4

Matching Genes:

gi|115250076|emb|CAJ67896.1| (electron transfer flavoprotein beta-subunit [Clostridium difficile 630])

Protein Group 23

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
460	15	7	7	17

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
109	641.63	1281.24	1280.66	69	ESTIEFLTSVR	37RepA_6
97	592.42	1182.83	1182.63	59	GISDFLLSFGK	37Rep_6
387	1151.78	2301.55	2301.01	77	HEFTTSDPGMTYSVAETSVDK	37RepA_6
445	773.59	2317.73	2317.01	62	HEFTTSDPGMTYSVAETSVDK +Oxidation (M)	37Rep_6
160	728.04	1454.07	1453.76	45	NVEHDFLKDPIK	37RepA_6
147	648.08	1294.14	1293.66	61	TCVVSLPVEYK	37Rep_6
286	990.34	1978.67	1978.03	87	VLSVLNVDYELASVDGGTK	37RepA_6

Matching Genes:

gi|115249724|emb|CAJ67541.1| (putative aminoacyl-histidine dipeptidase [Clostridium difficile 630])

Protein Group 24

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
442	12	9	6	20

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
54	529.99	1057.97	1057.60	56	AVTVAVEELK	37RepA_6
49	468.37	934.73	934.51	39	GTFDVVAVK	37Rep_6
44	501.87	1001.73	1001.51	64	IEDALNATR	37RepA_6
367	1075.41	2148.81	2148.22	48	ISNIQELLPVLEQIVQQGK	37Rep_6
2	407.36	812.71	812.51	41	LAGGVAVVK	37RepA_6
73	587.54	1173.07	1172.65	56	LIAEAMEIVGK	37RepA_6
367	709.12	2124.34	2125.19	29	LLIIAEDVEGEALSTLVVNK	37RepA_2
96	620.06	1238.11	1237.71	38	NVTAGANPILLR	37RepA_6
72	508.86	1015.72	1015.55	71	VGAATEVELK	37Rep_6

Matching Genes:

gi|115249204|emb|CAJ67016.1| (60 kDa chaperonin [Clostridium difficile 630])

Protein Group 25

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
434	15	8	8	41

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
136	501.34	1000.66	1000.56	48	GTQAVGIVEK	37Rep_3
96	518.45	1034.89	1034.65	51	IILLGPPGAGK	37RepA_3
510	1037.80	2073.59	2073.07	52	IQVYLDETKPLVDYYSK	37Rep_3
6	409.31	816.60	816.43	48	NAGISLDK	37Rep_3
42	429.40	856.79	856.50	47	QGIIADIK	37RepA_3
452	906.57	1811.12	1810.80	83	VEGVCDVCQGELYQR	37Rep_3
93	458.34	914.67	914.51	60	VVNIEVDK	37Rep_3
363	511.67	1531.98	1531.78	45	YNIPHISTGDIFR	37Rep_3

Matching Genes:

gi|115249098|emb|CAJ66909.1| (adenylate kinase [Clostridium difficile 630])

Protein Group 26

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
413	11	8	4	20

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
439	1220.98	2439.94	2439.29	28	DSPLVVGVGEGENFIASDIPALLK	37RepA_7
62	562.42	1122.82	1122.58	59	EHGNELVAVR	37RepA_6
93	583.37	1164.72	1164.59	35	EIHEQPTGVR	37Rep_7
356	1086.95	2171.90	2171.01	36	ESDDVFYTWAGPEVAVASTK	37RepA_7
221	749.57	1497.13	1496.67	98	GYDSAGVAVNSSNEK	37Rep_6
76	547.84	1093.66	1093.49	34	MVSNMEEVR	37RepA_7
189	733.52	1465.04	1464.74	63	TVVSSEHAFYLGR	37Rep_7
399	753.88	2258.62	2258.03	60	WATHGEPSDVNSHPHFNQAK	37Rep_7

Matching Genes:

gi|115249129|emb|CAJ66940.1| (glucosamine--fructose-6-phosphate aminotransferase [isomerizing] [Clostridium difficile 630])

Protein Group 27

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
378	15	6	3	26

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
409	558.44	1672.29	1671.87	33	IADELTQLKDEIER	37Rep_3
226	839.70	1677.39	1676.84	36	IRDTDVASEMVNLSK	37RepA_4
235	847.67	1693.33	1692.84	38	IRDTDVASEMVNLSK +Oxidation (M)	37RepA_4
103	535.38	1068.74	1068.51	44	ISSSTEFNGK	37RepA_3
491	1159.81	2317.61	2317.11	139	LESTQNNLNNTLENVTAAESR	37Rep_4
453	910.15	1818.28	1817.88	88	TLSLQSANEINNTEER	37Rep_3

Matching Genes:

gi|115249247|emb|CAJ67060.1| (flagellin subunit [Clostridium difficile 630])

Protein Group 28

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
377	11	6	5	30

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
237	710.96	1419.90	1419.67	74	EIMDAANNTGASVK	37RepA_2
399	718.93	1435.84	1435.66	77	EIMDAANNTGASVK +Oxidation (M)	37Rep_2
110	558.97	1115.93	1115.60	60	LINNLMVDGK	37RepA_2
223	566.90	1131.78	1131.60	48	LINNLMVDGK +Oxidation (M)	37Rep_2
385	704.46	1406.91	1406.69	29	REVLPDPMYGSK +Oxidation (M)	37Rep_2
281	618.90	1235.78	1235.60	89	TGEEALEVFNK	37Rep_2

Matching Genes:

gi|115249073|emb|CAJ66884.1| (30S ribosomal protein S7 [Clostridium difficile 630])

Protein Group 29

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
377	11	8	6	17

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
236	825.44	1648.87	1648.67	51	FAGMDLGMNFEEEK +2 Oxidation (M)	37RepA_7
249	862.49	1722.96	1722.85	66	FIDNGIGMTEEEIKK	37RepA_7
98	594.94	1187.87	1187.64	45	LVSLGEISENK	37Rep_7
143	671.08	1340.14	1339.77	39	TLVINENSPIIK	37RepA_7
247	826.72	1651.43	1650.90	41	VIEPLNDTNPLWLK	37Rep_7
317	965.24	1928.47	1927.84	61	WISEGGTEYEISESDAR	37Rep_7
186	486.18	1455.51	1454.76	32	WLYSDKDIFIR	37RepA_7
268	925.77	1849.53	1848.87	42	YINQVAFSGAEDFFNK	37RepA_7

Matching Genes:

gi|115249282|emb|CAJ67095.1| (chaperone protein (heat shock protein) [Clostridium difficile 630])

Protein Group 30

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
360	18	7	6	27

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
18	416.84	831.67	831.45	53	CLALLDK	37Rep_4
327	1038.03	2074.04	2073.12	33	ILIPMINEAVGIYADGVASK	37RepA_4
164	637.44	1272.87	1272.73	48	LVEVISGQLTSK	37Rep_4
405	681.87	2042.58	2042.08	69	SINKVPVDVSESPGFVVNR	37Rep_4
202	801.15	1600.29	1599.83	52	VPVDVSESPGFVVNR	37RepA_4
122	643.51	1285.01	1284.66	64	VTFDTVFELSK	37RepA_4
102	547.90	1093.78	1093.64	41	YRPHPLLAK	37Rep_4

Matching Genes:

gi|115250079|emb|CAJ67899.1| (3-hydroxybutyryl-CoA dehydrogenase [Clostridium difficile 630])

Protein Group 31

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
349	10	6	5	24

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
497	1179.39	2356.76	2356.16	56	GLLEEDLTEMNLSSVGDIIHR +Oxidation (M)	37Rep_4
344	913.24	1824.47	1823.96	82	HSIIVLAEGVGSASDLEK	37Rep_4
340	908.26	1814.50	1813.94	74	TIGLLTSGGDAPGMNAAIR	37Rep_4
276	916.23	1830.45	1829.93	36	TIGLLTSGGDAPGMNAAIR +Oxidation (M)	37RepA_4
207	673.93	1345.84	1345.62	52	VFDKEAYEMAK +Oxidation (M)	37Rep_4
48	504.86	1007.71	1007.59	49	VTVLGHVQR	37RepA_4

Matching Genes:

gi|115252455|emb|CAJ70298.1| (6-phosphofructokinase [Clostridium difficile 630])

Protein Group 32

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
343	9	7	5	23

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
324	1069.51	2137.01	2136.05	56	EGVFAGGDAVTGAATVISAMGAGK	37RepA_6
98	593.92	1185.83	1185.60	53	LGSESYIVYR	37Rep_6
177	460.05	1377.13	1376.60	31	MELGEPDDSGRR +Oxidation (M)	37Rep_6
76	591.47	1180.93	1180.60	26	TAAASIDEYLK	37RepA_6
228	864.26	1726.50	1725.91	70	VAVIGSGPAGLACAGDLAK	37RepA_6
185	702.09	1402.16	1401.70	63	VAVVGGGNVAMDAAR +Oxidation (M)	37Rep_6
285	989.26	1976.50	1975.92	44	VCPQESQCEGVCILGIK	37RepA_6

Matching Genes:

gi|115250578|emb|CAJ68402.1| (putative glutamate synthase [NADPH] small chain [Clostridium difficile 630])

Protein Group 33

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
343	12	8	6	39

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
124	580.49	1158.97	1158.68	47	ALVFENVLVR	37RepA_3
21	415.83	829.66	829.47	44	EGVIVASR	37Rep_3
178	565.86	1129.70	1129.56	57	ESGDIAGTPGVK	37Rep_3
444	891.60	1781.18	1780.85	36	FKPLSQPGQYACEEK	37Rep_3
254	428.18	1281.51	1281.58	29	HIHMSNEDATK	37Rep_3
47	428.34	854.66	854.52	42	LPIALSNK	37Rep_3
177	565.38	1128.74	1128.58	42	LVGPAGEVEMK	37Rep_3
183	573.38	1144.75	1144.58	46	LVGPAGEVEMK +Oxidation (M)	37Rep_3

Matching Genes:

gi|115251734|emb|CAJ69569.1| (putative propanediol utilization protein [Clostridium difficile 630])

Protein Group 34

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
328	10	6	6	18

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
314	962.31	1922.60	1921.92	69	AEGIEATEEEFKAELEK	37Rep_6
378	1092.33	2182.65	2182.05	53	ELDIDPIDNPDLDIEEISK	37Rep_6
503	1309.38	2616.74	2616.20	42	ELSALDDEFAKDTSEFDSLDELK	37Rep_6
151	652.90	1303.79	1303.54	49	MASAYNMEVEK +2 Oxidation (M)	37Rep_6
144	644.93	1287.84	1287.55	52	MASAYNMEVEK +Oxidation (M)	37Rep_6
77	531.06	1060.10	1059.62	63	SSLVLEAITK	37Rep_6

Matching Genes:

gi|115252362|emb|CAJ70203.1| (trigger factor [Clostridium difficile 630])

Protein Group 35

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
323	9	6	5	15

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
167	676.55	1351.08	1350.79	64	IVEVPVGEALIGR	37Rep_6
177	501.46	1501.37	1500.82	29	MNLKPEEISSIIK	37RepA_6
231	770.56	1539.11	1538.81	54	TRPVESEAPGIIDR	37Rep_6
220	566.12	1695.34	1694.91	50	TRPVESEAPGIIDRR	37RepA_6
470	1212.43	2422.85	2422.25	67	VELTDTGSVLTVGDGIASVYGLEK	37Rep_6
112	613.97	1225.92	1225.67	59	VVNSLGQPIDGK	37Rep_6

Matching Genes:

gi|115252530|emb|CAJ70373.1| (ATP synthase alpha chain [Clostridium difficile 630])

Protein Group 36

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
304	9	6	3	40

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
225	573.88	1145.74	1145.58	54	ETEGEIEVLK	37Rep_2
359	1038.75	2075.49	2075.03	39	EYLPQQLSEEELEEIVK	37RepA_2
71	458.42	914.83	914.59	51	KSVVTLIR	37RepA_2
138	605.93	1209.85	1209.59	36	STISEVGATSMK	37RepA_2
146	613.91	1225.80	1225.59	33	STISEVGATSMK +Oxidation (M)	37RepA_2
429	764.98	1527.95	1527.80	91	VELDEDGIIDVIAK	37Rep_2

Matching Genes:

gi|115251499|emb|CAJ69332.1| (putative tRNA binding protein [Clostridium difficile 630])

Protein Group 37

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
298	8	5	5	31

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
365	978.22	1954.43	1953.98	81	AIANSDLGLNPSNDGEVIR	37RepA_3
61	435.28	868.54	868.44	42	FEFGTIR	37Rep_3
164	545.88	1089.74	1089.52	48	GGELTEDELK	37Rep_3
136	609.90	1217.79	1217.61	56	GGELTEDELKK	37RepA_3
566	1194.36	2386.70	2386.22	71	VDYYGTPTPINQIGAISVPEPR	37Rep_3

Matching Genes:

gi|115251191|emb|CAJ69022.1| (ribosome recycling factor [Clostridium difficile 630])

Protein Group 38

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
295	10	5	5	10

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
48	466.35	930.69	930.50	57	LEDAVAVSK	37Rep_6
113	648.07	1294.12	1293.68	58	MVLGFLTDIGGR +Oxidation (M)	37RepA_6
100	594.95	1187.89	1187.60	56	SIDNVEAEIAK	37Rep_6
236	791.09	1580.16	1579.77	75	TESVNAEYALNEIK	37Rep_6
187	706.97	1411.93	1411.55	49	WAGMCGESAGDQK +Oxidation (M)	37Rep_6

Matching Genes:

gi|115251808|emb|CAJ69643.1| (phosphoenolpyruvate-protein phosphotransferase [Clostridium difficile 630])

Protein Group 39

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
294	9	6	5	13

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
349	1040.71	2079.41	2078.92	45	AAEETGLPYAGFDGDQADPR	37RepA_5
42	468.39	934.76	934.48	48	AQFEEAIK	37RepA_5
149	674.01	1346.00	1345.68	57	LLIEELEDNMK	37RepA_5
180	682.05	1362.08	1361.67	50	LLIEELEDNMK +Oxidation (M)	37Rep_5
404	1118.89	2235.76	2235.02	38	RAAEETGLPYAGFDGDQADPR	37RepA_5
294	603.50	1807.48	1806.95	56	VVINDLLAEQYANAFK	37Rep_5

Matching Genes:

gi|115249403|emb|CAJ67218.1| (subunit of oxygen-sensitive 2-hydroxyisocaproyl-CoA dehydratase [Clostridium difficile 630])

Protein Group 40

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
284	7	7	4	17

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
84	532.95	1063.89	1063.52	45	AGMMGIPYPK	37Rep_5
188	733.61	1465.20	1464.73	25	DLGKPYGVEAAMAK +Oxidation (M)	37RepA_5
47	482.43	962.85	962.54	27	GISAFIVEK	37RepA_5
98	578.93	1155.84	1155.64	56	HLVYQAAINK	37Rep_5
75	510.93	1019.84	1019.51	48	IAMSTLDGGR	37Rep_5
78	518.93	1035.84	1035.50	32	IAMSTLDGGR +Oxidation (M)	37Rep_5
214	763.03	1524.04	1523.75	51	ITEIYEGTSEVQR	37RepA_5

Matching Genes:

gi|115250075|emb|CAJ67895.1| (butyryl-CoA dehydrogenase [Clostridium difficile 630])

Protein Group 41

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
272	9	6	4	15

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
86	565.46	1128.91	1128.62	27	EPSLGPVFGVK	37Rep_6
91	581.94	1161.87	1161.59	50	FPLDTEAELK	37Rep_6
468	1206.31	2410.61	2410.15	48	IYGADGVDYTPEADKEIANLEK	37Rep_6
278	969.84	1937.66	1936.99	51	LGNIIVGYSYEGEPVTAR	37RepA_6
261	856.72	1711.42	1711.87	70	SDIEIAQEAKPQDIR	37Rep_6
22	432.87	863.72	863.48	26	VDYNLLK	37RepA_6

Matching Genes:

gi|115249735|emb|CAJ67552.1| (formate--tetrahydrofolate ligase [Clostridium difficile 630])

Protein Group 42

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
270	10	4	4	8

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
217	744.08	1486.15	1485.80	77	IITNQADAEAIVTK	37Rep_6
172	705.08	1408.14	1407.72	40	SFLGTSDVDIIGGK	37RepA_5
217	737.94	1473.86	1473.63	84	SGGSEDTGYVVEMK +Oxidation (M)	37Rep_5
232	774.02	1546.03	1545.69	69	YYNSDDKNAITDK	37Rep_6

Matching Genes:

gi|115251846|emb|CAJ69681.1| (cell surface protein (S-layer precursor protein) [Clostridium difficile 630])

Protein Group 43

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
259	6	5	4	21

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
426	864.60	1727.19	1726.88	51	EGITSVGENKPQELAR	37Rep_3
464	934.21	1866.41	1865.85	65	GLMTMAPFIEDEDEIR	37Rep_3
471	942.13	1882.25	1881.85	60	GLMTMAPFIEDEDEIR +Oxidation (M)	37Rep_3
167	552.41	1102.80	1102.57	31	IALCEEIQK	37Rep_3
83	483.35	964.69	964.50	52	VGTSIFGER	37RepA_3

Matching Genes:

gi|115251674|emb|CAJ69509.1| (putative alanine racemase [Clostridium difficile 630])

Protein Group 44

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
255	9	5	3	17

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
91	560.92	1119.83	1119.58	56	FEGETLPSLK	37Rep_5
114	620.97	1239.92	1239.54	34	LNYSNMPEEK +Oxidation (M)	37RepA_5
261	826.25	1650.48	1649.82	49	MIYVIPDFQNPTGR	37Rep_5
95	567.92	1133.83	1133.55	32	MQGLQGSEIR +Oxidation (M)	37Rep_5
445	1204.44	2406.86	2406.20	84	TNVNKDDILVTSGSQQGLDFAGK	37RepA_5

Matching Genes:

gi|115252729|emb|CAJ70573.1| (putative amino acid aminotransferase [Clostridium difficile 630])

Protein Group 45

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
254	6	4	3	11

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
282	903.23	1804.44	1803.94	81	AGFVVSDSNIKPDNTLK	37Rep_6
165	672.58	1343.15	1342.72	61	GQATSIIEVAQAR	37Rep_6
41	443.84	885.66	885.47	86	VGAGNVVDR	37Rep_6
287	918.70	1835.39	1834.85	26	VSEFMTPMSSIVYANK +2 Oxidation (M)	37Rep_6

Matching Genes:

gi|115251390|emb|CAJ69222.1| (inosine-5'-monophosphate dehydrogenase [Clostridium difficile 630])

Protein Group 46

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
252	6	4	4	4

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
138	636.94	1271.86	1271.60	57	AQANEPLTEDGK	37Rep_8
183	686.97	1371.93	1371.72	87	IGAEVDSGDILVGK	37Rep_8
53	514.46	1026.90	1026.58	42	LSALGPGGLSR	37RepA_8
211	723.47	1444.93	1444.70	66	VLTDEDQEIEVR	37Rep_8

Matching Genes:

gi|115249070|emb|CAJ66881.1| (DNA-directed RNA polymerase beta chain [Clostridium difficile 630])

Protein Group 47

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
252	7	4	4	31

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
189	510.36	1018.71	1018.57	53	EIISSITTR	37Rep_2
365	680.37	1358.73	1358.69	79	IECQGEGLVNLK	37Rep_2
406	734.48	1466.95	1466.87	74	LVNDVELVNVLIK	37Rep_2
198	664.98	1327.95	1327.70	46	NVPVNIWPYAR	37RepA_2

Matching Genes:

gi|115249997|emb|CAJ67817.1| (hypothetical phage protein [Clostridium difficile 630])

Other Genes Matching Peptide Subset:

gi|115251944|emb|CAJ69780.1| (hypothetical phage protein [Clostridium difficile 630])

Protein Group 48

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
242	6	4	4	32

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
551	733.96	1465.90	1465.78	69	AGSQVSGPVPLPTEK	37Rep_1
276	798.10	1594.19	1593.87	57	KAGSQVSGPVPLPTEK	37RepA_1
281	541.35	1080.69	1080.62	67	LIDIANPTPK	37Rep_1
30	425.82	849.62	849.46	49	LLDFSAGK	37RepA_1

Matching Genes:

gi|115249076|emb|CAJ66887.1| (30S ribosomal protein S10 [Clostridium difficile 630])

Protein Group 49

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
238	7	6	3	22

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
213	612.95	1223.89	1223.63	42	AGATYVSPFVGR	37Rep_3
112	480.36	958.71	958.52	46	IPMTAEGLK	37Rep_3
110	558.41	1114.80	1114.61	38	MGADIATVPLK	37RepA_3
179	566.40	1130.78	1130.60	34	MGADIATVPLK +Oxidation (M)	37Rep_3
172	559.89	1117.77	1117.64	37	NPIHVLQAAR	37Rep_3
33	423.36	844.71	844.48	41	VINQMIK	37Rep_3

Matching Genes:

gi|115251384|emb|CAJ69216.1| (putative transaldolase [Clostridium difficile 630])

Protein Group 50

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
236	7	5	2	28

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
240	422.96	1265.87	1265.75	34	EGKLPVVKPGSR	37Rep_3
477	962.21	1922.41	1922.00	74	FPEYAAEVLSTVVEQIK	37Rep_3
237	630.05	1258.09	1257.72	65	IIIAEDVVTTGK	37Rep_3
79	476.91	951.80	951.59	35	LPVVKPGSR	37RepA_3
378	788.47	1574.93	1574.78	28	TNHDIGMPIYSAIK +Oxidation (M)	37Rep_3

Matching Genes:

gi|115249197|emb|CAJ67009.1| (orotate phosphoribosyltransferase [Clostridium difficile 630])

Protein Group 51

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
235	5	4	4	37

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
244	738.09	1474.16	1473.79	71	IGVIGGGSITYPNAR	37RepA_1
127	572.36	1142.71	1142.52	69	LSETDEFFR	37RepA_1
215	478.28	954.54	954.47	46	TYSEGAISK	37Rep_1
330	606.39	1816.16	1815.89	49	VFGSLDDKTYSEGAISK	37RepA_1

Matching Genes:

gi|115251040|emb|CAJ68871.1| (putative decarboxylase [Clostridium difficile 630])

Protein Group 52

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
235	6	4	3	46

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
98	515.38	1028.74	1028.55	67	IANGEIPSTK	37RepA_1
300	567.34	1132.66	1132.55	55	KLPNYEAGQN	37Rep_1
556	738.90	1475.78	1475.67	83	VINNCGSDGGQEVK	37Rep_1
401	740.55	2218.63	2218.25	30	VLAFNDLNPVAPYHILVVPK	37RepA_1

Matching Genes:

gi|115251501|emb|CAJ69334.1| (histidine triad nucleotide-binding protein [Clostridium difficile 630])

Protein Group 53

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
228	6	5	3	14

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
163	669.44	1336.87	1336.61	53	DTDPQSALEYAK	37Rep_6
484	832.71	2495.10	2494.24	42	ENSLHVMGLLSDGGVHSHIDHLK	37Rep_6
352	1049.86	2097.71	2096.97	75	EVQASMDEIGVGEFATVSGR +Oxidation (M)	37Rep_6
345	1037.81	2073.61	2073.00	30	VATYDLKPEMSAYELTDK	37Rep_6
307	1045.80	2089.58	2088.99	28	VATYDLKPEMSAYELTDK +Oxidation (M)	37RepA_6

Matching Genes:

gi|115252228|emb|CAJ70068.1| (2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Clostridium difficile 630])

Protein Group 54

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
227	7	4	4	33

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
217	556.40	1110.79	1110.64	47	ADLDLRPALK	37Rep_2
113	564.96	1127.91	1127.54	41	ANVQYYGTGR	37RepA_2
332	656.47	1310.93	1310.73	96	LVAGEGNILVNGR	37Rep_2
139	606.98	1211.94	1211.65	43	QPLVLTGNENK	37RepA_2

Matching Genes:

gi|115249113|emb|CAJ66924.1| (30S ribosomal protein S9 [Clostridium difficile 630])

Protein Group 55

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
227	7	4	4	52

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
366	679.16	2034.45	2034.06	54	EQPQIAEVVEVGPGGIVEGK	37RepA_1
354	611.35	1220.69	1220.64	58	IEGQEYTILR	37Rep_1
74	454.80	907.58	907.43	46	MELTVGDK +Oxidation (M)	37RepA_1
283	542.85	1083.69	1083.63	69	TASGIVLPGAAK	37Rep_1

Matching Genes:

gi|115249203|emb|CAJ67015.1| (10 kDa chaperonin [Clostridium difficile 630])

Protein Group 56

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
226	8	5	2	12

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
272	638.86	1913.56	1912.98	36	AIGDNLTCIFVDHGLLR	37RepA_6
43	445.87	889.73	889.50	37	FDINLIR	37Rep_6
373	1084.34	2166.67	2166.08	76	GIIFTGGPNSAYLEDSPTISK	37Rep_6
63	488.90	975.79	975.54	42	IIGEEFIR	37Rep_6
49	511.94	1021.86	1021.49	35	MPYDVLER	37RepA_6

Matching Genes:

gi|115249206|emb|CAJ67019.1| (GMP synthase [glutamine-hydrolyzing] [Clostridium difficile 630])

Protein Group 57

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
222	6	5	3	13

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
14	420.89	839.76	839.49	34	APSIPSLR	37RepA_6
175	748.89	1495.76	1495.66	40	EMGDNCSVTILNK +Oxidation (M)	37RepA_6
431	757.91	2270.72	2270.05	44	NSLTNKPTWSPMGSSANHEGR	37Rep_6
193	793.12	1584.24	1583.77	36	TLSTGEKENLSYDK	37RepA_6
203	732.10	1462.18	1461.82	68	VLEGGILFYPNLK	37Rep_6

Matching Genes:

gi|115250843|emb|CAJ68667.1| (putative pyridine nucleotide-disulfide oxidoreductase [Clostridium difficile 630])

Protein Group 58

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
219	6	4	3	12

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
59	465.37	928.72	928.56	55	IGIEGSILK	37Rep_5
130	646.04	1290.06	1289.70	64	ILVLNCGSSSLK	37RepA_5
260	822.74	1643.47	1642.88	38	MLLIPTNEELMIAR	37Rep_5
262	827.06	1652.12	1651.75	62	YGFHGTSHNYVSQR	37Rep_5

Matching Genes:

gi|115250207|emb|CAJ68028.1| (acetate kinase [Clostridium difficile 630])

Protein Group 59

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
216	7	5	2	7

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
267	892.20	1782.39	1781.79	41	DVEFGELNSQDKDMR	37Rep_7
453	1208.36	2414.70	2414.09	27	MINSEEFNGLDASEGFEGIIDK	37Rep_7
461	1216.39	2430.76	2430.09	39	MINSEEFNGLDASEGFEGIIDK +Oxidation (M)	37Rep_7
54	481.87	961.72	961.52	29	YTIHSTLK	37Rep_7
213	771.99	1541.97	1541.66	80	YVDSNNENEPFSK	37Rep_7

Matching Genes:

gi|115251575|emb|CAJ69408.1| (leucyl-tRNA synthetase [Clostridium difficile 630])

Protein Group 60

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
215	4	3	3	15

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
335	901.78	1801.54	1801.01	93	ILFVAGGVGSAPVYPQVK	37Rep_4
77	588.45	1174.88	1175.62	46	IPLTIADYDR	37RepA_4
322	883.08	1764.14	1763.78	76	NVYVSTDDGTYGFNGR	37Rep_4

Matching Genes:

gi|115250577|emb|CAJ68401.1| (putative dehydrogenase, electron transfer subunit [Clostridium difficile 630])

Protein Group 61

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
213	10	4	3	28

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
370	776.05	1550.09	1549.72	30	EVSWLPSYGPEMR	37Rep_3
104	538.37	1074.72	1074.57	62	FKDDVIPGGK	37RepA_3
176	493.89	985.77	985.62	62	IIVNSSLIK	37Rep_2
556	1155.76	2309.51	2309.11	59	TDVDVYYIPANELAAELGNDK	37Rep_3

Matching Genes:

gi|115249127|emb|CAJ66938.1| (putative subunit of oxidoreductase [Clostridium difficile 630])

Protein Group 62

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
203	5	4	3	36

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
616	894.36	2680.06	2679.19	46	DMNEFGAINEVYAEYFGENKPAR +Oxidation (M)	37Rep_2
407	744.88	2231.61	2231.13	70	HEVIHTNDAPAALGPYSQAIK	37RepA_1
728	831.24	2490.70	2490.27	61	MKHEVIHTNDAPAALGPYSQAIK	37Rep_1
733	836.32	2505.94	2506.26	26	MKHEVIHTNDAPAALGPYSQAIK +Oxidation (M)	37Rep_1

Matching Genes:

gi|115251566|emb|CAJ69399.1| (putative translation inhibitor endoribonuclease [Clostridium difficile 630])

Protein Group 63

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
203	5	4	3	18

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
74	578.91	1155.80	1155.52	66	FFEGDIEGSR	37RepA_4
71	573.41	1144.81	1144.59	42	HFETIANSVK	37RepA_4
104	628.05	1254.08	1253.75	59	LPIILYNVPGR	37RepA_4
410	824.31	2469.91	2469.18	36	VPVIAGSGSNDTMHSVNLSQEAEK	37RepA_4

Matching Genes:

gi|115252282|emb|CAJ70123.1| (dihydrodipicolinate synthase [Clostridium difficile 630])

Other Genes Matching Peptide Subset:

gi|115252280|emb|CAJ70121.1| (dihydrodipicolinate synthase [Clostridium difficile 630])

Protein Group 64

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
202	4	4	4	24

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
264	870.95	1739.88	1738.88	65	AAALDTFETEGLFLNK	37RepA_5
267	844.17	1686.33	1685.88	43	GGLINTGDLIEALESGK	37Rep_5
496	1321.49	2640.96	2640.31	50	GLGANVIAFDQYPNSDLNDILTYK	37Rep_7
509	1354.96	2707.90	2707.30	44	GYDGISIQQTNYIDNPYIYETLK	37Rep_7

Matching Genes:

gi|115249400|emb|CAJ67215.1| ((R)-2-hydroxyisocaproate dehydrogenase [Clostridium difficile 630])

Protein Group 65

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
202	5	3	3	5

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
201	532.04	1593.11	1592.78	44	AGTNMERPGPLAAHR +Oxidation (M)	37RepA_6
282	809.12	1616.23	1615.81	88	IVLEENEQSLPMSK	37RepA_3
399	817.07	1632.12	1631.81	70	IVLEENEQSLPMSK +Oxidation (M)	37Rep_3

Matching Genes:

gi|115252300|emb|CAJ70141.1| (proline reductase subunit proprotein [Clostridium difficile 630])

Protein Group 66

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
195	7	5	2	6

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
141	456.70	1367.09	1366.68	53	FWATELTEDKK	37RepA_8
258	571.46	1711.37	1710.88	54	KGDEVYYVSKPLADK	37Rep_8
179	456.64	1366.90	1366.72	32	LNAHETANKLEK	37Rep_8
205	582.45	1744.33	1743.81	26	SLEEQNLNDHMTGIK +Oxidation (M)	37RepA_8
140	456.68	1367.02	1366.64	30	VVHNYPHCWR	37RepA_8

Matching Genes:

gi|115251669|emb|CAJ69504.1| (isoleucyl-tRNA synthetase [Clostridium difficile 630])

Protein Group 67

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
192	5	4	3	13

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
126	495.35	988.68	988.49	27	DIKPEEMK	37Rep_3
101	532.92	1063.83	1063.54	53	VAAMIYGPDK	37RepA_3
160	540.85	1079.69	1079.53	59	VAAMIYGPDK +Oxidation (M)	37Rep_3
91	456.91	911.80	911.58	53	VIVIAGVNK	37Rep_3

Matching Genes:

gi|115251115|emb|CAJ68946.1| (conserved hypothetical protein [Clostridium difficile 630])

Protein Group 68

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
183	9	4	2	16

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
163	634.53	1267.05	1266.73	38	ALVPVVVEQTGR	37RepA_3
132	602.48	1202.94	1202.61	47	ETLNEILSER	37RepA_3
334	723.01	1444.01	1443.79	61	IKETLNEILSER	37Rep_3
59	444.37	886.72	886.42	37	SYDIFSR	37RepA_3

Matching Genes:

gi|115252361|emb|CAJ70202.1| (ATP-dependent Clp protease proteolytic subunit [Clostridium difficile 630])

Protein Group 69

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
182	4	4	2	10

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
235	788.56	1575.11	1574.66	57	EFECYTQEQVDK	37Rep_6
94	586.49	1170.96	1170.61	37	IAGVEIPEDTK	37Rep_6
173	747.54	1493.07	1492.72	60	NIEYAGENIEVSR	37RepA_6
65	494.38	986.74	986.54	28	SVGIIDIDR	37Rep_6

Matching Genes:

gi|115251397|emb|CAJ69229.1| (succinate-semialdehyde dehydrogenase [NAD(P)+] [Clostridium difficile 630])

Protein Group 70

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
178	5	3	3	11

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
241	831.65	1661.28	1660.76	54	AHCSTVGAGEFLQER	37RepA_5
215	839.18	1676.34	1675.81	62	EVVFAADDNVVGENAK	37RepA_6
201	745.61	1489.20	1488.72	62	MENGDVVLLENTR	37RepA_5

Matching Genes:

gi|115252230|emb|CAJ70070.1| (phosphoglycerate kinase [Clostridium difficile 630])

Protein Group 71

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
171	7	4	2	25

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
312	574.79	1721.35	1720.92	35	KPEEVISHAVSGMLPK	37RepA_2
475	580.03	1737.07	1736.91	44	KPEEVISHAVSGMLPK +Oxidation (M)	37Rep_2
137	604.99	1207.97	1207.62	36	KWYLVDAEGK	37RepA_2
210	547.81	1093.60	1093.56	56	YHTGYVGGLK	37Rep_2

Matching Genes:

gi|115249112|emb|CAJ66923.1| (50S ribosomal protein L13 [Clostridium difficile 630])

Protein Group 72

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
169	5	3	2	9

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
84	608.37	1214.73	1214.52	36	NYDKEEFDR	37RepA_6
385	1098.87	2195.73	2195.04	71	QLATEEGYETFVIPDDVGGR	37Rep_6
102	625.97	1249.93	1249.63	62	SGTTTEPALAFR	37RepA_6

Matching Genes:

gi|115252341|emb|CAJ70182.1| (glucose-6-phosphate isomerase [Clostridium difficile 630])

Protein Group 73

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
167	5	4	2	37

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
633	584.37	1750.09	1749.89	34	HQKPSAMNQQGGIINK	37Rep_1
636	589.65	1765.93	1765.89	44	HQKPSAMNQQGGIINK +Oxidation (M)	37Rep_1
112	543.93	1085.85	1085.64	30	KGDTVVVIAGK	37RepA_1
134	585.93	1169.84	1169.70	59	VLVEGVNVITK	37RepA_1

Matching Genes:

gi|115249088|emb|CAJ66899.1| (50S ribosomal protein L24 [Clostridium difficile 630])

Protein Group 74

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
166	5	3	3	22

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
87	486.92	971.83	971.53	56	ILGEGNLEK	37RepA_2
340	440.64	1318.91	1318.74	41	LHELKPAEGAVR	37Rep_2
303	631.42	1260.83	1260.63	69	VGFEGGQMPLAR	37Rep_2

Matching Genes:

gi|115249096|emb|CAJ66907.1| (50S ribosomal protein L15 [Clostridium difficile 630])

Protein Group 75

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
161	5	3	3	23

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
231	583.40	1164.79	1164.60	45	EQALVEVSYK	37Rep_2
403	730.59	1459.17	1458.78	70	ILGGGLPYESAVQR	37Rep_2
198	530.84	1059.67	1058.60	46	VKVETGIDAK	37Rep_2

Matching Genes:

gi|115249807|emb|CAJ67624.1| (putative NUDIX-family hydrolase [Clostridium difficile 630])

Protein Group 76

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
160	5	3	2	29

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
239	730.50	1458.99	1458.76	81	AEGDTISANLDLLK	37RepA_1
236	479.59	1435.74	1435.63	46	SLDNGDLDHEHGK	37RepA_1
113	544.37	1086.72	1086.54	33	VCIPVEENK	37RepA_1

Matching Genes:

gi|115250736|emb|CAJ68560.1| (putative dinitrogenase iron-molybdenum cofactor [Clostridium difficile 630])

Protein Group 77

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
160	6	3	2	9

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
192	528.78	1583.32	1582.75	41	FGTATHSGFGLGFER	37RepA_6
92	617.48	1232.95	1232.57	37	IDYTQDFFGK	37RepA_6
229	869.64	1737.26	1736.85	82	SIVVEGESDSSYPLQK	37RepA_6

Matching Genes:

gi|115251299|emb|CAJ69130.1| (asparaginyl-tRNA synthetase [Clostridium difficile 630])

Protein Group 78

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
159	6	3	3	17

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
88	487.30	972.59	972.54	47	GLHDYIKK	37RepA_2
98	530.45	1058.89	1058.61	70	LASGFPIGLGK	37RepA_2
195	529.30	1056.58	1056.49	42	NISEEYFR	37Rep_2

Matching Genes:

gi|115252075|emb|CAJ69912.1| (conserved hypothetical protein [Clostridium difficile 630])

Protein Group 79

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
159	4	3	3	22

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
400	481.98	1442.92	1442.66	48	AHNDANMLSLGER +Oxidation (M)	37Rep_2
235	591.83	1181.65	1181.57	57	CAVVSDVFSAK	37Rep_2
206	541.40	1080.78	1080.57	54	EIISYLESK	37Rep_2

Matching Genes:

gi|115252540|emb|CAJ70383.1| (ribose-5-phosphate isomerase 2 [Clostridium difficile 630])

Protein Group 80

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
157	5	2	2	16

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
390	800.51	1599.00	1598.72	72	NLSDNHESQEAEVK	37Rep_3
241	739.04	1476.06	1475.76	85	VEAGIYNEILNNK	37RepA_3

Matching Genes:

gi|115252635|emb|CAJ70478.1| (putative preprotein translocase [Clostridium difficile 630])

Protein Group 81

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
154	7	4	2	30

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
242	498.27	994.53	994.46	38	GYDVIEDGK	37Rep_1
107	545.46	1088.90	1088.62	43	ILLEEGFIR	37RepA_2
224	698.95	1395.89	1395.64	25	TMTDPIADMLTR +2 Oxidation (M)	37RepA_1
126	571.38	1140.74	1140.59	48	VYAANHEIPK	37RepA_1

Matching Genes:

gi|115249091|emb|CAJ66902.1| (30S ribosomal protein S8 [Clostridium difficile 630])

Protein Group 82

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
153	6	4	1	11

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
113	615.94	1229.86	1229.60	37	HVFEGESNIAK	37Rep_6
413	1121.49	2240.97	2241.13	26	IIPNEASQEAALNNGEISLMK	37Rep_6
68	579.43	1156.84	1156.51	25	NEMIESAYGK +Oxidation (M)	37RepA_6
219	846.59	1691.16	1690.74	65	SNSNLQTYTYSEER	37RepA_6

Matching Genes:

gi|115251723|emb|CAJ69558.1| (oligopeptide ABC transporter, substrate-binding protein [Clostridium difficile 630])

Protein Group 83

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
152	4	3	3	15

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
382	793.07	1584.12	1583.83	51	GVWNFAPLDLEVPK	37Rep_3
135	500.80	999.59	999.51	50	NGAQEVINR	37Rep_3
82	482.88	963.74	963.50	51	YLGDLLDR	37RepA_3

Matching Genes:

gi|115249180|emb|CAJ66992.1| (putative DNA-binding protein [Clostridium difficile 630])

Protein Group 84

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
152	4	3	3	11

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
135	588.91	1175.81	1175.61	51	ALLDAFHYAR	37RepA_1
438	791.47	1580.93	1580.79	55	NTDIKEEYLSEIK	37Rep_2
89	511.82	1021.63	1021.47	46	SDMQVVTDK	37Rep_4

Matching Genes:

gi|115250155|emb|CAJ67976.1| (nitroreductase-family protein [Clostridium difficile 630])

Protein Group 85

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
151	7	3	2	14

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
54	520.43	1038.84	1038.62	41	AEAIVKPGVR	37RepA_4
469	1007.48	3019.43	3018.50	30	DDISQMLVSDPTSIFYLTGVLIHPGER +Oxidation (M)	37RepA_4
298	680.92	1359.83	1359.78	80	FLLNLIELGGGSK	37Rep_3

Matching Genes:

gi|115251664|emb|CAJ69499.1| (probable peptidase [Clostridium difficile 630])

Protein Group 86

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
149	4	3	2	24

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
226	706.99	1411.97	1411.68	64	QNFGQVSNSYIR	37RepA_3
391	1081.84	2161.67	2160.97	26	TGEGDGDDEEILVNLETMPK	37RepA_3
440	887.63	1773.26	1772.86	59	VEKDEDFIFYNNLK	37Rep_3

Matching Genes:

gi|115250676|emb|CAJ68500.1| (tellurium resistance protein [Clostridium difficile 630])

Protein Group 87

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
149	4	2	2	19

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
326	905.18	1808.35	1807.91	65	SIMGIMSLGLAQGEELK +2 Oxidation (M)	37RepA_1
319	897.20	1792.39	1791.91	84	SIMGIMSLGLAQGEELK +Oxidation (M)	37RepA_1

Matching Genes:

gi|115251809|emb|CAJ69644.1| (PTS system, phosphocarrier protein [Clostridium difficile 630])

Protein Group 88

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
146	3	3	2	7

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
422	835.28	2502.82	2502.18	36	GVAAVVGCSNMTAGGHDVNTVELTK +Oxidation (M)	37Rep_8
238	810.10	1618.18	1617.80	64	LVGCTCVGQDLQLR	37Rep_8
76	516.44	1030.86	1030.59	46	LVTEVLTEK	37Rep_8

Matching Genes:

gi|115249184|emb|CAJ66996.1| (putative oxidoreductase, acetyl-CoA synthase subunit [Clostridium difficile 630])

Protein Group 89

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
145	4	3	1	40

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
170	452.26	902.51	902.56	36	KLAYPIAK	37Rep_1
373	685.16	2052.46	2052.02	31	NYELVYVVKPNSDEEVR	37RepA_1
219	694.02	1386.02	1385.78	78	VKEVVATDGEIVK	37RepA_1

Matching Genes:

gi|115252728|emb|CAJ70572.1| (30S ribosomal protein S6 [Clostridium difficile 630])

Protein Group 90

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
136	4	3	2	41

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
204	675.39	1348.77	1348.59	68	GCGLCVEACPVK	37RepA_1
165	628.98	1255.94	1255.71	42	IIQLDSNVINK	37RepA_1
57	440.32	878.63	878.42	26	VSFNQER	37RepA_1

Matching Genes:

gi|115249124|emb|CAJ66935.1| (ferredoxin [Clostridium difficile 630])

Protein Group 91

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
135	4	3	2	7

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
181	721.44	1440.87	1440.76	53	GVVDVYPNKPEPK	37RepA_7
314	962.33	1922.65	1921.94	56	SLGLAGVMGGANSEITSNTK +Oxidation (M)	37Rep_7
420	796.71	2387.10	2386.19	26	YVGTLGELHPDVIENYNLGQR	37RepA_7

Matching Genes:

gi|115249716|emb|CAJ67533.1| (phenylalanyl-tRNA synthetase beta chain [Clostridium difficile 630])

Protein Group 92

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
129	4	3	1	20

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
148	458.30	914.58	914.45	34	AEINPDTR	37Rep_2
72	465.93	929.84	929.52	33	ATANEILAK	37RepA_2
56	420.83	839.65	839.49	62	IAGVDLPR	37Rep_2

Matching Genes:

gi|115249103|emb|CAJ66914.1| (30S ribosomal protein S13 [Clostridium difficile 630])

Protein Group 93

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
124	2	2	2	5

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
470	1242.38	2482.74	2482.19	54	EALEELGLPYTINEGDGAFYGPK	37Rep_7
77	551.92	1101.82	1101.54	70	EVADNNVSVR	37RepA_7

Matching Genes:

gi|115249589|emb|CAJ67406.1| (threonyl-tRNA synthetase [Clostridium difficile 630])

Protein Group 94

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
118	4	2	2	15

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
226	706.99	1411.97	1411.68	64	QNFGQVSNSYIR	37RepA_3
441	889.14	1776.26	1775.81	54	TGEGDGDDEQIVVDLSK	37Rep_3

Matching Genes:

gi|115250675|emb|CAJ68499.1| (tellurium resistance protein [Clostridium difficile 630])

Protein Group 95

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
117	3	2	1	15

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
123	584.90	1167.78	1167.58	35	ESVDFPIYAK	37RepA_2
165	624.41	1246.81	1246.60	82	GIEVEDVGTNSK	37RepA_2

Matching Genes:

gi|115251375|emb|CAJ69207.1| (ribose-5-phosphate isomerase 1 [Clostridium difficile 630])

Protein Group 96

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
117	3	3	1	12

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
400	1003.26	2004.50	2003.92	34	DVYACCTHGVLSGPAIER	37Rep_4
116	579.39	1156.77	1156.54	39	MIFSNESVSK +Oxidation (M)	37Rep_4
117	580.49	1158.97	1158.64	44	TVAPLFGDAIR	37Rep_4

Matching Genes:

gi|115252575|emb|CAJ70418.1| (ribose-phosphate pyrophosphokinase [Clostridium difficile 630])

Protein Group 97

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
116	4	3	2	11

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
72	574.95	1147.89	1147.56	43	NAETQGYPIR	37RepA_4
76	473.38	944.75	944.48	25	NVEVEEVK	37RepA_3
151	532.84	1063.66	1063.58	48	VAVDTPAHVR	37Rep_3

Matching Genes:

gi|115249126|emb|CAJ66937.1| (putative subunit of oxidoreductase [Clostridium difficile 630])

Protein Group 98

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
114	2	2	2	8

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
274	855.07	1708.12	1708.83	48	NTSMLDAFAVADDVLK	37Rep_5
118	642.51	1283.01	1282.67	66	VIGVGGGGNNAVNR	37RepA_4

Matching Genes:

gi|115251697|emb|CAJ69532.1| (cell division protein [Clostridium difficile 630])

Protein Group 99

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
109	2	2	2	11

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
209	671.97	1341.92	1341.71	54	LENIIQNEELK	37RepA_2
275	785.61	1569.21	1568.88	55	VKLENIIQNEELK	37RepA_2

Matching Genes:

gi|115251313|emb|CAJ69144.1| (conserved hypothetical protein [Clostridium difficile 630])

Protein Group 100

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
106	2	2	1	5

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
218	738.00	1473.99	1473.76	78	FVIGGPQGDTGLTGR	37Rep_5
17	407.27	812.53	813.50	28	LVELVNK	37Rep_1

Matching Genes:

gi|115249139|emb|CAJ66950.1| (S-adenosylmethionine synthetase [Clostridium difficile 630])

Protein Group 101

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
104	3	2	2	8

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
373	682.89	2045.65	2045.05	46	VLWPFPFEAFNQIPNAR	37Rep_5
122	640.52	1279.02	1278.65	58	VMTSSSSPGVALK +Oxidation (M)	37RepA_5

Matching Genes:

gi|115249125|emb|CAJ66936.1| (putative oxidoreductase, thiamine diP-binding subunit [Clostridium difficile 630])

Protein Group 102

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
104	2	2	1	4

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
239	543.28	1626.82	1626.77	36	IKEHNHNVGTCYR	37Rep_8
382	1122.87	2243.73	2243.14	68	SLGNGIDPLEIIEQYGADALR	37RepA_7

Matching Genes:

gi|115252312|emb|CAJ70153.1| (valyl-tRNA synthetase [Clostridium difficile 630])

Protein Group 103

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
102	3	1	1	5

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
314	930.23	1858.45	1857.88	102	TIDEDESGALNPELVEK	37Rep_5

Matching Genes:

gi|115251648|emb|CAJ69481.1| (low-specificity L-threonine aldolase [Clostridium difficile 630])

Protein Group 104

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
101	3	3	1	5

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
103	599.55	1197.08	1196.71	31	QLVPNLTTAIK	37Rep_6
123	621.04	1240.07	1239.65	40	VDAPEILDNVR	37Rep_6
32	460.38	918.74	918.45	30	YALDYFK	37RepA_6

Matching Genes:

gi|115249342|emb|CAJ67155.1| (manganese-dependent inorganic pyrophosphatase [Clostridium difficile 630])

Protein Group 105

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
100	2	2	1	15

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
474	946.31	1890.60	1889.90	66	EAEQAGADFVGAEELVQK	37Rep_3
467	624.47	1870.38	1869.94	34	FYDASEALTLVSDIAGAK	37Rep_3

Matching Genes:

gi|115249066|emb|CAJ66877.1| (50S ribosomal protein L1 [Clostridium difficile 630])

Protein Group 106

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
99	2	2	2	6

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
336	904.17	1806.32	1805.85	59	AGATIGGANSEQMEEITK	37Rep_4
342	912.14	1822.26	1821.84	40	AGATIGGANSEQMEEITK +Oxidation (M)	37Rep_4

Matching Genes:

gi|115250238|emb|CAJ68059.1| (geranyltranstransferase [Clostridium difficile 630])

Protein Group 107

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
99	4	2	2	12

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
69	564.40	1126.78	1126.54	56	LQAEYANYR	37RepA_4
301	976.20	1950.38	1949.87	43	TDEKEVDDENVTDINSK	37RepA_4

Matching Genes:

gi|115251516|emb|CAJ69349.1| (heat shock protein [Clostridium difficile 630])

Protein Group 108

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
98	2	1	1	9

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
437	881.61	1761.20	1760.81	98	TGVGDGDDEQINVDLSK	37Rep_3

Matching Genes:

gi|115250845|emb|CAJ68669.1| (tellurium resistance protein [Clostridium difficile 630])

Protein Group 109

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
98	2	2	1	11

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
411	1034.82	2067.62	2066.98	30	EALDENGLENVGIMAYSVK +Oxidation (M)	37Rep_4
286	937.34	1872.66	1872.01	68	EGLLNEDVILESITSIK	37RepA_4

Matching Genes:

gi|115252479|emb|CAJ70322.1| (delta-aminolevulinic acid dehydratase [Clostridium difficile 630])

Protein Group 110

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
96	2	1	1	10

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
330	935.69	1869.38	1868.91	96	LAGEGGLFFVDQEFANR	37RepA_2

Matching Genes:

gi|115251248|emb|CAJ69079.1| (ferritin [Clostridium difficile 630])

Protein Group 111

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
96	3	2	1	21

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
408	734.54	1467.06	1466.75	59	LNDDAIIPNFAHK	37Rep_2
528	696.75	2087.23	2087.05	37	TGICIELPTMTEAQVRPR +Oxidation (M)	37Rep_2

Matching Genes:

gi|115251455|emb|CAJ69288.1| (deoxyuridine 5'-triphosphate nucleotidohydrolase [Clostridium difficile 630])

Protein Group 112

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
95	2	2	1	20

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
146	457.31	912.60	912.56	57	AVLELAGLK	37Rep_2
421	827.06	2478.16	2477.28	38	GHFGAGNILIMPAVEGTGVIAGGPAR +Oxidation (M)	37RepA_2

Matching Genes:

gi|115249094|emb|CAJ66905.1| (30S ribosomal protein S5 [Clostridium difficile 630])

Protein Group 113

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
95	2	2	1	8

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
107	630.01	1258.01	1257.66	60	AGINTVEELANK	37RepA_4
234	748.16	1494.30	1493.92	35	ILLSSLPGVAVNAIK	37Rep_5

Matching Genes:

gi|115249106|emb|CAJ66917.1| (DNA-directed RNA polymerase alpha chain [Clostridium difficile 630])

Protein Group 114

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
94	2	2	2	18

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
340	928.74	1855.47	1854.88	49	GTQFNEGGMPTYSLPLK +Oxidation (M)	37RepA_3
398	716.51	1431.01	1430.76	45	VTSTGIVNGVIEDK	37Rep_2

Matching Genes:

gi|115252223|emb|CAJ70063.1| (putative phosphatidylethanolamine-binding regulatory protein [Clostridium difficile 630])

Protein Group 115

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
92	3	2	2	24

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
475	671.47	1340.92	1340.73	41	LGSPVVEGASVQAK	37Rep_1
353	611.28	1220.54	1220.63	51	VSEGDVLFVEK	37Rep_1

Matching Genes:

gi|115250193|emb|CAJ68014.1| (50S ribosomal protein L21 [Clostridium difficile 630])

Protein Group 116

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
90	3	2	1	31

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
651	914.67	1827.32	1826.94	62	AEGDTGSPEVQIALLTAR	37Rep_1
101	519.38	1036.75	1036.57	28	INELNGHLK	37RepA_1

Matching Genes:

gi|115250352|emb|CAJ68174.1| (30S ribosomal protein S15 [Clostridium difficile 630])

Protein Group 117

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
89	4	2	1	16

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
296	625.44	1248.86	1248.67	56	LAVENNVSYLK	37Rep_2
354	958.22	1914.43	1913.84	33	TYNNTQWDENYPLEK	37RepA_3

Matching Genes:

gi|115249853|emb|CAJ67670.1| (putative acetyltransferase [Clostridium difficile 630])

Protein Group 118

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
89	3	2	2	7

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
134	610.35	1218.68	1218.55	40	ALQEAEGNMEK	37Rep_4
162	693.57	1385.13	1384.73	49	EGITLQEVLNNR	37RepA_5

Matching Genes:

gi|115251193|emb|CAJ69024.1| (elongation factor Ts [Clostridium difficile 630])

Protein Group 119

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
88	2	2	2	16

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
96	460.33	918.64	918.52	45	FEILEIR	37Rep_3
384	696.15	2085.44	2084.99	43	VAISFGDLSENAEYDEAKK	37RepA_3

Matching Genes:

gi|115252616|emb|CAJ70459.1| (transcription elongation factor [Clostridium difficile 630])

Protein Group 120

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
85	3	1	1	9

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
276	797.11	1592.21	1591.86	85	APVSNFAYLIDAIAK	37RepA_3

Matching Genes:

gi|115249067|emb|CAJ66878.1| (50S ribosomal protein L10 [Clostridium difficile 630])

Protein Group 121

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
85	3	2	1	6

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
185	654.92	1307.83	1307.60	54	AATPDVNSENYK	37Rep_4
39	454.36	906.70	906.48	31	EAYGQVLK	37RepA_4

Matching Genes:

gi|115251376|emb|CAJ69208.1| (transketolase [Clostridium difficile 630])

Protein Group 122

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
82	1	1	1	5

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
207	607.92	1213.83	1213.67	82	AGENLLSLLER	37Rep_3

Matching Genes:

gi|115249105|emb|CAJ66916.1| (30S ribosomal protein S4 [Clostridium difficile 630])

Protein Group 123

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
82	1	1	1	6

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
318	876.68	1751.35	1751.85	82	VYVNTNSLHFQSTDK	37Rep_4

Matching Genes:

gi|115252284|emb|CAJ70125.1| (2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase [Clostridium difficile 630])

Protein Group 124

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
80	1	1	1	6

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
302	854.18	1706.35	1705.90	80	AAINSLTQNIATQYAK	37RepA_3

Matching Genes:

gi|115249069|emb|CAJ66880.1| (NADP-dependent 7-alpha-hydroxysteroid dehydrogenase [Clostridium difficile 630])

Protein Group 125

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
80	2	2	1	10

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
183	437.02	1308.03	1307.69	47	KENIAIQEAHR	37RepA_3
212	458.62	1372.84	1372.66	33	QAQDAIKDEAER	37RepA_3

Matching Genes:

gi|115251194|emb|CAJ69025.1| (30S ribosomal protein S2 [Clostridium difficile 630])

Protein Group 126

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
77	2	1	1	15

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
299	839.14	1676.27	1675.83	77	VETQGATGIDNELTTK	37RepA_1

Matching Genes:

gi|115252071|emb|CAJ69908.1| (PTS system, IIb component [Clostridium difficile 630])

Protein Group 127

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
76	2	2	1	4

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
102	627.99	1253.96	1253.81	33	KVTGKPTVIIAK	37RepA_4
68	564.00	1125.99	1125.71	43	VTGKPTVIIAK	37RepA_4

Matching Genes:

gi|115251377|emb|CAJ69209.1| (transketolase [Clostridium difficile 630])

Protein Group 128

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
75	2	2	1	4

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
204	500.36	1498.07	1497.70	45	IGSGPSSSHTMGPQR	37RepA_5
241	505.58	1513.73	1513.69	30	IGSGPSSSHTMGPQR +Oxidation (M)	37Rep_5

Matching Genes:

gi|115252279|emb|CAJ70120.1| (L-serine dehydratase [Clostridium difficile 630])

Protein Group 129

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
70	2	2	1	8

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
228	488.27	974.52	975.49	43	GTLDTAGVDK	37Rep_1
124	566.87	1131.72	1131.59	27	GTLDTAGVDKR	37RepA_1

Matching Genes:

gi|115249072|emb|CAJ66883.1| (30S ribosomal protein S12 [Clostridium difficile 630])

Protein Group 130

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
70	1	1	1	6

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
310	869.17	1736.33	1735.76	70	ADIDYGFAEADTTYGK	37Rep_4

Matching Genes:

gi|115249083|emb|CAJ66894.1| (30S ribosomal protein S3 [Clostridium difficile 630])

Protein Group 131

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
70	2	1	1	16

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
321	900.16	1798.31	1797.88	70	FIEEIGYYNPISEPK	37RepA_1

Matching Genes:

gi|115250287|emb|CAJ68109.1| (30S ribosomal protein S16 [Clostridium difficile 630])

Protein Group 132

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
70	1	1	1	4

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
260	779.04	1556.07	1555.76	70	SIQAIDSHTAGEATR	37Rep_4

Matching Genes:

gi|115252294|emb|CAJ70135.1| (putative proline racemase [Clostridium difficile 630])

Protein Group 133

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
68	2	2	0	37

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
575	505.91	1514.70	1514.77	31	EQVVVKEDNAQTR	37Rep_1
102	522.87	1043.73	1043.56	37	SVIGTTPNQK	37RepA_1

Matching Genes:

gi|115249095|emb|CAJ66906.1| (50S ribosomal protein L30 [Clostridium difficile 630])

Protein Group 134

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
67	2	1	1	19

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
544	724.96	1447.90	1447.74	67	FQLATGQLENTAR	37Rep_1

Matching Genes:

gi|115249085|emb|CAJ66896.1| (50S ribosomal protein L29 [Clostridium difficile 630])

Protein Group 135

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
67	2	1	1	12

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
172	636.47	1270.92	1270.69	67	QNINIVDISQK	37RepA_1

Matching Genes:

gi|115251678|emb|CAJ69513.1| (conserved hypothetical protein [Clostridium difficile 630])

Protein Group 136

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
66	1	1	1	12

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
311	861.62	1721.22	1720.82	66	GYDVSSISTPDLENPK	37RepA_1

Matching Genes:

gi|115249013|emb|CAJ66824.1| (anti-sigma-B factor (serine-protein kinase) [Clostridium difficile 630])

Protein Group 137

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
66	3	2	0	9

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
51	473.36	944.71	944.39	31	FEEDMFK	37Rep_6
556	1221.39	3661.16	3659.97	35	IEGLEYFLIPTAEVPVTNIHANEILDVAELPIK	37RepA_6

Matching Genes:

gi|115249017|emb|CAJ66828.1| (seryl-tRNA synthetase [Clostridium difficile 630])

Other Genes Matching Peptide Subset:

gi|115251893|emb|CAJ69728.1| (seryl-tRNA synthetase [Clostridium difficile 630])

Protein Group 138

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
65	1	1	1	7

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
360	762.55	1523.08	1522.75	65	VDSVEGYTVGQEIK	37Rep_3

Matching Genes:

gi|115249077|emb|CAJ66888.1| (50S ribosomal protein L3 [Clostridium difficile 630])

Protein Group 139

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
65	1	1	1	7

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
404	822.70	1643.38	1642.86	65	GFIYTLTESKPYPK	37Rep_3

Matching Genes:

gi|115252732|emb|CAJ70576.1| (conserved hypothetical protein [Clostridium difficile 630])

Protein Group 140

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
64	2	2	0	10

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
223	780.09	1558.17	1557.73	37	TIGVMYNTSEVNSK +Oxidation (M)	37RepA_5
378	1041.29	2080.57	2080.03	27	TLEKPGTNVSGTSDFVSVDK	37Rep_5

Matching Genes:

gi|115249887|emb|CAJ67706.1| (ABC transporter, substrate-binding lipoprotein [Clostridium difficile 630])

Protein Group 141

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
64	2	2	0	42

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
352	632.02	1893.05	1892.79	28	MEATGFVSCPQCHEPK +Oxidation (M)	37RepA_1
132	581.37	1160.73	1160.46	36	VCPDCGYYK	37RepA_1

Matching Genes:

gi|115250209|emb|CAJ68030.1| (50S ribosomal protein L32 [Clostridium difficile 630])

Protein Group 142

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
63	1	1	1	9

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
540	745.95	2234.82	2234.16	63	NIEGVQTALVNTMNVYDILK	37Rep_3

Matching Genes:

gi|115249078|emb|CAJ66889.1| (50S ribosomal protein L4 [Clostridium difficile 630])

Protein Group 143

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
63	2	2	0	14

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
100	534.41	1066.80	1066.51	31	FAPDYNVNK	37RepA_2
250	736.60	1471.18	1470.80	32	IYSSLYLEDLKK	37RepA_2

Matching Genes:

gi|115250371|emb|CAJ68193.1| (MarR-family transcriptional regulator [Clostridium difficile 630])

Protein Group 144

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
63	2	1	1	9

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
427	760.00	1517.98	1517.81	63	SPVDLIPFVEAGFK	37Rep_2

Matching Genes:

gi|115252122|emb|CAJ69960.1| (PTS system, IIb component [Clostridium difficile 630])

Protein Group 145

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
63	2	1	1	7

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
186	652.54	1303.06	1302.59	63	SAEFCANYITK	37RepA_2

Matching Genes:

gi|115252727|emb|CAJ70571.1| (single-strand binding protein [Clostridium difficile 630])

Protein Group 146

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
62	1	1	1	4

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
474	868.57	1735.13	1734.89	62	VITGLATSDDDSSITIK	37Rep_2

Matching Genes:

gi|115251108|emb|CAJ68939.1| (aspartokinase [Clostridium difficile 630])

Protein Group 147

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
62	2	2	0	10

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
182	502.28	1002.55	1002.49	35	DLDVDIEGK	37Rep_2
185	504.25	1006.48	1006.50	27	MLTEEQIK +Oxidation (M)	37Rep_2

Matching Genes:

gi|115251742|emb|CAJ69577.1| (putative phosphoribosyltransferase [Clostridium difficile 630])

Protein Group 148

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
62	1	1	1	3

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
188	778.10	1554.19	1553.78	62	GIPVSIGTDGAPSNNR	37RepA_6

Matching Genes:

gi|115251756|emb|CAJ69591.1| (putative amidohydrolas [Clostridium difficile 630])

Protein Group 149

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
62	3	1	1	8

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
503	1022.31	2042.61	2042.21	62	AIEEAGIPTIIIAALPPVVR	37Rep_3

Matching Genes:

gi|115252298|emb|CAJ70139.1| (proline reductase [Clostridium difficile 630])

Protein Group 150

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
62	2	1	1	22

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
564	745.43	1488.85	1488.71	62	EAEEGCPVSAITVK	37Rep_1

Matching Genes:

gi|115252670|emb|CAJ70513.1| (ferredoxin [Clostridium difficile 630])

Protein Group 151

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
59	2	1	1	5

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
139	503.80	1005.59	1005.51	59	VPGATYAEAK	37Rep_3

Matching Genes:

gi|115251487|emb|CAJ69320.1| (conserved hypothetical protein [Clostridium difficile 630])

Protein Group 152

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
57	2	2	0	4

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
178	755.14	1508.27	1507.78	30	FGHLHQSVDDLIK	37RepA_6
33	462.39	922.76	922.49	27	FPYEIVR	37RepA_6

Matching Genes:

gi|115251396|emb|CAJ69228.1| (gamma-aminobutyrate metabolism dehydratase/isomerase [includes: 4-hydroxybutyryl-coa dehydratase; vinylacetyl-coa-delta-isomerase] [Clostridium difficile 630])

Protein Group 153

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
56	2	1	1	10

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
504	693.43	1384.85	1385.70	56	ELVPNTTDAAVEK	37Rep_1

Matching Genes:

gi|115249844|emb|CAJ67661.1| (rubredoxin oxidoreductase (desulfoferrodoxin) [Clostridium difficile 630])

Protein Group 154

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
55	2	1	1	3

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
214	742.05	1482.08	1481.70	55	SHEEGISPEEVAAK	37Rep_6

Matching Genes:

gi|115249055|emb|CAJ66866.1| (cysteinyl-tRNA synthetase [Clostridium difficile 630])

Protein Group 155

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
55	2	1	1	8

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
299	849.31	1696.60	1696.03	55	VALVGGGIGVAPLYLVAK	37RepA_3

Matching Genes:

gi|115249195|emb|CAJ67007.1| (dihydroorotate dehydrogenase electron transfer subunit [Clostridium difficile 630])

Protein Group 156

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
54	1	1	1	7

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
121	556.95	1111.88	1111.62	54	ILVPIDGTER	37RepA_1

Matching Genes:

gi|115249829|emb|CAJ67646.1| (putative universal stress protein [Clostridium difficile 630])

Protein Group 157

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
54	1	1	1	13

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
178	456.32	910.62	910.50	54	GPQAANVVR	37Rep_1

Matching Genes:

gi|115250391|emb|CAJ68213.1| (putative cold shock protein [Clostridium difficile 630])

Protein Group 158

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
54	1	1	1	1

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
85	561.37	1120.72	1120.61	54	FVGSTLEQLK	37Rep_7

Matching Genes:

gi|115251485|emb|CAJ69318.1| (glycyl-tRNA synthetase beta chain [Clostridium difficile 630])

Protein Group 159

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
54	2	1	1	7

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
353	748.05	1494.08	1493.85	54	AGVVLNPATPVDTIK	37Rep_3

Matching Genes:

gi|115251631|emb|CAJ69464.1| (ribulose-phosphate 3-epimerase [Clostridium difficile 630])

Protein Group 160

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
54	2	1	1	2

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
273	911.26	1820.50	1819.88	54	SLYSSSEEPVTPPSNVK	37Rep_7

Matching Genes:

gi|115251820|emb|CAJ69655.1| (cell surface protein [Clostridium difficile 630])

Protein Group 161

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
54	1	1	1	19

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
492	686.85	1371.68	1371.59	54	CACGNTFVAGSTK	37Rep_1

Matching Genes:

gi|115252547|emb|CAJ70390.1| (50S ribosomal protein L31 [Clostridium difficile 630])

Protein Group 162

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
53	2	1	1	4

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
182	504.36	1510.05	1509.83	53	ISSKPIIATHSNSR	37RepA_4

Matching Genes:

gi|115252633|emb|CAJ70476.1| (probable dipeptidase [Clostridium difficile 630])

Protein Group 163

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
52	2	1	1	7

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
271	783.05	1564.09	1563.75	52	TGAIREESFNPSEK	37RepA_3

Matching Genes:

gi|115250279|emb|CAJ68101.1| (elongation factor P [Clostridium difficile 630])

Protein Group 164

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
52	2	1	1	5

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
247	638.41	1274.81	1274.60	52	NQDVSDEDILK	37Rep_3

Matching Genes:

gi|115251628|emb|CAJ69461.1| (putative nitroreductase [Clostridium difficile 630])

Protein Group 165

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
51	1	1	1	7

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
223	483.29	964.56	964.50	51	VINTSEFR	37Rep_1

Matching Genes:

gi|115250733|emb|CAJ68557.1| (thioredoxin [Clostridium difficile 630])

Protein Group 166

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
50	1	1	1	8

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
88	478.38	954.74	954.55	50	KYTFVVAK	37RepA_1

Matching Genes:

gi|115249079|emb|CAJ66890.1| (50S ribosomal protein L23 [Clostridium difficile 630])

Protein Group 167

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
50	1	1	1	9

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
311	580.42	1158.83	1158.62	50	KAGQICDLVR	37Rep_1

Matching Genes:

gi|115249082|emb|CAJ66893.1| (50S ribosomal protein L22 [Clostridium difficile 630])

Protein Group 168

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
49	1	1	1	7

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
350	941.78	1881.54	1880.88	49	TPLVIATTGYNDDEMNK	37RepA_3

Matching Genes:

gi|115252283|emb|CAJ70124.1| (dihydrodipicolinate reductase [Clostridium difficile 630])

Protein Group 169

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
48	2	1	1	1

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
84	561.33	1120.65	1120.58	48	KMIEENTIK +Oxidation (M)	37Rep_7

Matching Genes:

gi|115250692|emb|CAJ68516.1| (putative signaling protein [Clostridium difficile 630])

Protein Group 170

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
48	1	1	1	22

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
173	636.48	1270.94	1270.70	48	LIDEALEDLIK	37RepA_1

Matching Genes:

gi|110666931|ref|YP_659585.1| (hypothetical protein CDP09 [Clostridium difficile 630])

Protein Group 171

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
47	1	1	1	3

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
417	1158.60	2315.19	2315.23	47	IATLIPIDGNDENEYLLLATK	37Rep_7

Matching Genes:

gi|115249009|emb|CAJ66820.1| (DNA gyrase subunit A [Clostridium difficile 630])

Protein Group 172

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
46	2	1	1	17

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
568	1148.13	2294.25	2293.12	46	LADVAELDTLLSDKEYEAGLE	37Rep_2

Matching Genes:

gi|115249746|emb|CAJ67563.1| (putative glycine cleavage system H protein [Clostridium difficile 630])

Protein Group 173

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
46	1	1	1	9

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
240	716.09	1430.16	1429.74	46	VTVDENTIGQINK	37RepA_2

Matching Genes:

gi|115251795|emb|CAJ69630.1| (putative D-tyrosyl-tRNA protein [Clostridium difficile 630])

Protein Group 174

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
44	1	1	1	2

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
115	637.37	1272.72	1272.63	44	LPEPQFEGQTK	37RepA_7

Matching Genes:

gi|115249008|emb|CAJ66819.1| (DNA gyrase subunit B [Clostridium difficile 630])

Protein Group 175

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
44	2	1	1	4

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
115	575.89	1149.77	1149.60	44	LISHTPEPEK	37Rep_4

Matching Genes:

gi|115249057|emb|CAJ66868.1| (putative thymidylate synthase [Clostridium difficile 630])

Protein Group 176

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
43	1	1	1	3

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
17	425.89	849.76	849.47	43	VVVTGYGR	37RepA_4

Matching Genes:

gi|115249402|emb|CAJ67217.1| (activator of 2-hydroxyisocaproyl-CoA dehydratase [Clostridium difficile 630])

Protein Group 177

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
43	1	1	1	2

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
226	800.66	1599.30	1598.76	43	TYVSAYHSTNLSEK	37RepA_7

Matching Genes:

gi|115251837|emb|CAJ69672.1| (cell surface protein [Clostridium difficile 630])