Figures
Abstract
5’-3’ decay is the major mRNA decay pathway in many eukaryotes, including trypanosomes. After deadenylation, mRNAs are decapped by the nudix hydrolase DCP2 of the decapping complex and finally degraded by the 5’-3’ exoribonuclease. Uniquely, trypanosomes lack homologues to all subunits of the decapping complex, while deadenylation and 5’-3’ degradation are conserved. Here, I show that the parasites use an ApaH-like phosphatase (ALPH1) as their major mRNA decapping enzyme. The protein was recently identified as a novel trypanosome stress granule protein and as involved in mRNA binding. A fraction of ALPH1 co-localises exclusively with the trypanosome 5’-3’ exoribonuclease XRNA to a special granule at the posterior pole of the cell, indicating a connection between the two enzymes. RNAi depletion of ALPH1 is lethal and causes a massive increase in total mRNAs that are deadenylated, but have not yet started 5’-3’ decay. These data suggest that ALPH1 acts downstream of deadenylation and upstream of mRNA degradation, consistent with a function in mRNA decapping. In vitro experiments show that recombinant, N-terminally truncated ALHP1 protein, but not a catalytically inactive mutant, sensitises the capped trypanosome spliced leader RNA to yeast Xrn1, but only if an RNA 5’ polyphosphatase is included. This indicates that the decapping mechanism of ALPH1 differs from the decapping mechanism of Dcp2 by leaving more than one phosphate group at the mRNA’s 5’ end. This is the first reported function of a eukaryotic ApaH-like phosphatase, a bacterial-derived class of enzymes present in all phylogenetic super-groups of the eukaryotic kingdom. The substrates of eukaryotic ApaH-like phosphatases are unknown. However, the substrate of the related bacterial enzyme ApaH, diadenosine tetraphosphate, is highly reminiscent of a eukaryotic mRNA cap.
Author summary
Eukaryotic mRNAs are stabilised by a 5’ cap and one important step in mRNA decay is the removal of this cap by the nudix domain protein Dcp2 of the decapping complex. The decapping complex is highly conserved throughout eukaryotes, with the exception of trypanosomes that lack the entire complex. Here, I show that trypanosomes have evolved to use an ApaH-like phosphatase instead of a nudix domain protein as their major decapping enzyme. This work closes an important gap in the knowledge of trypanosome mRNA metabolism. Moreover, this is the first reported function of an ApaH-like phosphatase, a bacterial derived class of enzymes that are widespread throughout eukaryotes.
Citation: Kramer S (2017) The ApaH-like phosphatase TbALPH1 is the major mRNA decapping enzyme of trypanosomes. PLoS Pathog 13(6): e1006456. https://doi.org/10.1371/journal.ppat.1006456
Editor: Kent L. Hill, University of California, Los Angeles, UNITED STATES
Received: February 9, 2017; Accepted: June 7, 2017; Published: June 19, 2017
Copyright: © 2017 Susanne Kramer. This is an open access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited.
Data Availability: All relevant data are within the paper and its Supporting Information files.
Funding: This work was funded by 'Deutsche Forschungsgemeinschaft' (Kr4017/1-2). The funders had no role in study design, data collection and analysis, decision to publish, or preparation of the manuscript.
Competing interests: The authors have declared that no competing interests exist.
Introduction
One hallmark of eukaryotic mRNAs is the mRNA cap, a 7-methyl-guanosine bound 5’-5’ to the mRNA’s 5’ end by a triphosphate bridge. Together with the poly(A) tail that is connected to the cap via the poly(A) binding protein and the eIF4F complex, the cap mediates mRNA circularisation and contributes to mRNA stabilisation. For mRNA degradation, the circular structure is resolved by the removal of the poly(A) tail by the deadenylase of the Caf1/Ccr4/Not complex. Deadenylated mRNAs are then targets for one of two alternative decay pathways. mRNA can be degraded 3’-5’ by the exosome followed by the hydrolysis of the remaining capped di- or oligo-nucleotides by the pyrophosphatase DcpS. Alternatively, mRNA is decapped by the Dcp1/Dcp2 complex, followed by 5’-3’ exonucleolytic decay by the major cytoplasmic exoribonuclease XRN1. In many eukaryotes, including yeast and trypanosomes, 5’-3’ decay is the dominant mRNA decay pathway. Enzymes of this decay pathway localise to RNA granules, cytoplasmic RNA protein aggregates of largely unknown function. Best studied are P-bodies, which are constitutively present and contain the mRNA decay machinery and stress granules, which are induced by exposure to cellular stress and contain translation initiation factors [1,2]. RNA granules are present in all eukaryotes, including trypanosomes [3].
The nudix hydrolase Dcp2 is the catalytic component of the decapping complex [4–7] Dcp2 cleaves the mRNA cap between the α and β phosphate, releasing m7GDP and 5’-end monophosphate RNA [4,7]. Dcp1 binds to Dcp2 and acts as an activator [8,9]. The activity of the Dcp1/Dcp2 complex is further increased by several decapping enhancers; the ones conserved from yeast to human are Edc3, Pat1, Dhh1, Scd6 and the Lsm1-7 complex [10]. Edc3 and Pat1 bind and stimulate Dcp2 directly [11,12]. Pat1 binds and recruits the Lsm1-7 complex which mediates the selective binding to deadenylated mRNA substrates [13]. The effects of the DEAD-box RNA helicase Dhh1 and the Lsm domain protein Scd6 on decapping are probably only indirectly: both repress translation which increases the amount of decay-competent mRNA substrates [14–16]. At least in mammals, two additional nudix domain proteins are involved in decapping a subset of mRNAs [10].
To date, mRNA decapping by nudix domain proteins, in particular by Dcp2, is the only known mechanism of mRNA cap removal in eukaryotes. The enzyme is widespread throughout the eukaryotic kingdom: it was described in yeast [17], mammals [7] and plants [18], but also in several deep-branching protozoa, for example Entamoeba histolytica [19] and Giardia lamblia [20]. One marked exception are Kinetoplastida, a heterogenic group of flagellated protozoa that include some prominent human pathogens such as Trypanosoma brucei, Trypanosoma cruzi and Leishmania. Kinetoplastida have neither homologues to Dcp1 and Dcp2 nor to the major decapping enhancers Pat1 or Edc3 [21] and they do not possess a cytoplasmic Lsm1-7 complex [22,23]. Only the translational repressors Dhh1 [24–26] and Scd6 [27,28] are conserved. Despite of the absence of the decapping complex, the release of m7GDP from mRNAs is detectable in vitro [29]: trypanosomes must have evolved a mechanism for mRNA decapping, that is different to the one of other eukaryotes. One reason for the trypanosome’s need of a different decapping mechanism could be the unusual mRNA cap that in Kinetoplastida is transferred from the spliced leader RNA to all polycistronically transcribed mRNAs in a trans-splicing reaction [30]. The cap is of the heavily methylated type 4: the first four transcribed nucleotides (AACU) have ribose 2’-O methylations and there are additional base methylations on the first (m62A) and fourth (m3U) position [31,32]. Importantly, the differences in mRNA decay between Kinetoplastids and other eukaryotes are restricted to the decapping complex. Trypanosomes have conserved homologues to all other mRNA decay components, including the exosome [33], the Xrn1 homologue XRNA [34,35] and the CAF1/NOT complex [36,37].
We have recently purified starvation stress granules from trypanosomes [38]. One of the newly identified granule proteins, here renamed ALPH1, is a strong candidate for the long-wanted trypanosome decapping enzyme, based on its predicted substrate specificities and on its exclusive co-localisation with XRNA to a special granule at the posterior pole of the cell. RNAi experiments confirm that TbALPH1 has all features required of an mRNA decapping enzyme: ALPH1 depletion is lethal and results in a massive, global increase in mRNAs, that are deadenylated but have not yet started degradation. In vitro experiments confirm that ALPH1 can sensitise a capped RNA to Xrn1 in the presence of an RNA 5’ polyphosphatase.
Results
Discovery and sequence analysis of TbALPH1
The protein with the Gene ID number Tb927.6.640 was identified both in stress granules [38] and within the mRNA-bound interactome [39]. Interestingly, the protein did not only localise to stress granules, but also to the posterior pole granule [38], a localisation that was so far only observed for the 5’-3’ exoribonuclease XRNA [40]. This observation indicates that Tb927.6.640 might belong to the same pathway as XRNA and perhaps is the long-wanted decapping enzyme.
Tb927.6.640 is annotated as a kinetoplastid-specific phospho-protein phosphatase (PPP) in the TriTryp database [21]. A closer analysis of the sequence reveals two changes in the conserved PPP signature motif GDXXDRG: the second aspartate is replaced by asparagine and arginine is replaced by lysine (Fig 1A). These changes are characteristic for an ApaH-like phosphatase (Alph), a subgroup of the PPP family that is closely related to the bacterial enzyme ApaH [41,42]. I will refer to Tb927.6.640 as TbALPH1. There are two further ApaH-like phosphatases in the T. brucei genome: Tb927.4.4330 (TbALPH2) and Tb927.8.8040 (TbALPH3) (S1 Fig), but neither was identified as stress granule component [38] or as involved in mRNA binding [39]. The substrates of eukaryotic ApaH-like phosphatases are unknown, even though these proteins are widespread throughout the eukaryotic kingdom [41]. The substrate of the bacterial ApaH protein, however, is diadenosine tetraphosphate [43,44], a molecule that resembles an eukaryotic mRNA cap (Fig 1B).
(A) Alignment of the signature motifs of a classical eukaryotic PPP (TbPP1, Tb927.4.3560) and the atypical PPPs ApaH of E. coli and ALPH1 of T. brucei. The three catalytic signature motifs of PPPs are framed. The two changes in the GDXXDRG motif that are characteristic for ApaH and Alph are highlighted in red. In Alph’s and ApaH, the second aspartate is replaced by a neutral amino acid (n). In most Alphs, but not in ApaH or other PPPs, arginine, a coordinator of phosphate [72], is replaced by lysine [41]. (B) Structure of diadenosine tetraphosphate (top) and of the mRNA cap of trypanosomes (bottom). The differences are marked in red. (C) Domain structure of ALPH1 and conservation between the different kinetoplastida orthologues. All available kinetoplastid orthologues to TbALPH1, (13 sequences of trypanosomes, 1 of Leptomonas and 6 of Leishmania strains) were aligned by ClustalW using default parameters. The minimal % identity between any two sequences is indicated for the three different ALPH domains. The sequences of trypanosomes and Leishmania/Leptomonas were also analysed separately.
TbALPH1 has 734 amino acids and is almost equally split into a C-terminal domain, the catalytic domain and an N-terminal domain (Fig 1C). ALPH1 of T. brucei and T. evansi also has an asparagine-rich region within the N-terminal domain. The protein appears to be unique to Kinetoplastida; there are similarities to both Alph’s of other eukaryotes and to bacterial ApaH proteins, but these are restricted to the catalytic domain. When all available ALPH1 sequences of the Kinetoplastida are aligned, there are 14.6%, 57.6% and 31.9% minimal identity between any two sequences in the C-terminal part, catalytic domain and N-terminal part of the protein, respectively (Fig 1C). Thus, the catalytic domain is best conserved, followed by the C-terminal domain and a rather poorly conserved N-terminal domain. When the ALPH1 sequences of Trypanosomes and Leishmania/Leptomonas were aligned separately, the percentages of minimal identities increased, but the N-terminal domain remained the least- and the catalytic domain the best-conserved domain (Fig 1C).
ALPH1 RNAi depletion causes growth arrest and increase in mRNA levels
If ALPH1 is involved in decapping of bulk mRNAs, its depletion should be lethal and cause stabilisation of total mRNAs. RNAi depletion of TbALPH1 was performed with the tetracycline inducible system described in [45]. Three populations of cells of clonal origin were analysed. The reduction in TbALPH1 mRNA was controlled by Affymetrix single molecule FISH with a green fluorescent probe antisense to ALPH1 and a red fluorescent probe antisense to a control mRNA (DBP1). There was a clear reduction in the number of ALPH1 mRNAs (from 6 to 1 molecule per cell), but not in the number of DBP1 mRNAs within 24 hours of tetracycline induction in all three clones, indicating that the RNAi was successful (Fig 2A). Next, growth was monitored over a time-course of RNAi induction. Cells stopped growth within 48 and 72 hours of RNAi induction (Fig 2B), indicating that TbALPH1 is an essential protein.
RNAi depletion of TbALPH1 was induced by tetracycline (TET). Three independent clonal cell lines were analysed over a time-course of RNAi induction. (A) Reduction in the number of ALPH1 mRNA molecules. ALPH1 mRNA and DBP1 mRNA (control) were visualized by dual colour single molecule mRNA FISH (Affymetrix), using green (ALPH1) and red (DBP1) fluorescent Affymetrix probe sets. The number of mRNA molecules per cell was quantified after 0, 24 and 48 hours of ALPH1 RNAi induction. Data are presented as box plot (waist is median; box is IQR; whiskers are ±1.5 IQR; only the smallest and largest outliers are shown; n = 100 for each time-point); the number of mRNAs from the individual cells is also presented as green (ALPH1) or red (DBP1) dots. One representative cell for each time-point is shown. The data are from one RNAi clone; data of a second clone are shown in S12 Fig. (B) Growth arrest. Growth was measured over a time-course of ALPH1 RNAi induction (±TET). Averages of the three clonal cell lines are shown; error bars indicate standard deviations between the three cell lines. (C-E) Increase in mRNAs. Total RNA was isolated over a time-course of ALPH1 RNAi and as a control from bloodstream form trypanosomes (BSF) and analysed by northern blots. The blots were probed for total mRNA with an oligo antisense to the miniexon of the spliced leader RNA (C), for PGKC (D) and for GPI-PLC (E). mRNA abundances were quantified by Odyssey (total mRNA) or phosphorimager (PGKC, GPI-PLC). rRNA was used as a loading control and all samples were calibrated to the amount of BSF RNA (= 1). Average values of the three clones are shown, standard deviations are presented as error bars. For each probe, one representative northern blot is shown. Note that the three red bands in C) are not rRNA bands, but are caused by a squeezing of the mRNAs due to the very abundant rRNA.
The effects of ALPH1 RNAi depletion on mRNA levels were examined. Total RNA was isolated over a time-course of ALPH1 RNAi induction and analysed by quantitative northern blots (Fig 2C–2E). The blots were probed for total mRNAs with an oligo antisense to the miniexon sequence that is trans-spliced to all trypanosome mRNAs, and for two individual mRNAs. The two individual mRNAs, GPI-phospholipase C (GPI-PLC) and phosphoglycerate kinase C (PGKC) were chosen because they are unstable in the procyclic life cycle stage, in which the experiments were performed [46–49]; unstable mRNAs show a larger increase in steady state levels at inhibition of RNA decay. Total RNA from bloodstream form (BSF) trypanosomes served as a control. RNAi depletion of ALPH1 caused a significant increase in mRNA levels for all mRNAs analysed. Total mRNA levels increased 1.7/2.2 fold after 48/72 hours of ALPH1 RNAi induction. For the two developmentally regulated mRNAs the increase was higher: GPI-PLC mRNA increased 4.2/4-6 fold and PGKC mRNA increased 16/22 fold after 48/72 hours of RNAi induction.
The data suggest that ALPH1 has an essential role in trypanosome mRNA metabolism. The RNAi phenotype of ALPH1 is very similar to the phenotype observed after RNAi depletion of XRNA: cells stop growth [50], total mRNA levels increase about 2-fold (S2 Fig) and there is a particular pronounced effect on unstable, developmentally regulated mRNAs [35,51].
The mRNAs that accumulate after ALPH1 RNAi depletion are deadenylated
If ALPH1 is the decapping enzyme, it should act downstream of mRNA deadenylation. Thus, the mRNAs that accumulate after ALPH1 depletion should have shorter poly(A) tails. Such a decrease in poly(A) tail length was observed after depletion of several yeast enzymes acting downstream of deadenylation, including Dcp2 [17], Xrn1 [52], Dcp1 [53] and Lsm1 [54].
In trypanosomes, the histone H4 mRNA is frequently used to report changes in poly(A) tail lengths [34,36]. The genes encoding histone H4 are organised as ten tandem repeats, producing mRNAs with an average size of 520 nucleotides (range 469–589), excluding the poly(A) tail. The small size of this mRNA allows the visualisation of changes in poly(A) tail lengths as band shifts on a northern blot, because the poly(A) tail occupies a large fraction of the total mRNA size [34,36].
When a northern blot with RNA harvested over a time-course of ALPH1 RNAi was probed for histone H4, there was a clear decrease in mRNA size starting at 48 hours of tetracycline induction (Fig 3A). Two experiments served to control that the band-shifted mRNA is indeed deadenylated (Fig 3B): First, when the RNA samples were treated with RNAse H in the presence of oligo (dT), the band shift was lost. Second, no band shift is detectable in RNAs without a poly(A) tail, namely the 5.8S rRNA or the SL RNA, even though both are significantly smaller than histone H4. As a negative control, I performed RNAi specific to the deadenylase CAF1 (S3 Fig). There was a mild increase in histone H4 mRNA size (Fig 3C), as previously reported [36]. As a positive control, I performed RNAi specific to XRNA [50]. I observed a decrease in histone H4 mRNA size (Fig 3D), as previously reported [34], similar to the effect seen after ALPH1 RNAi. The data are consistent with ALPH1 acting downstream of the mRNA deadenylase CAF1 on deadenylated mRNA substrates.
Northern blots were probed for histone H4, a very small mRNA that allows to visualise changes in poly(A) tail length by band shifts. (A) RNA was isolated over a time-course of ALPH1 RNAi depletion. Representative data from one of three RNAi clones are shown. (B) RNA isolated after 0 or 72 hours of ALPH1 RNAi depletion was treated with RNAse H in the absence or presence of oligo dT. Samples not treated with RNAse H served as control. The blot was re-probed for two small RNAs that have no poly(A) tail (5.8S rRNA and SL RNA) to demonstrate that the band-shift is specific to polyadenylated RNAs. (C) RNA was isolated over a time-course of CAF1 RNAi depletion. Representative data from one of three RNAi clones are shown. (D) RNA was isolated over a time-course of XRNA RNAi depletion. Representative data from one of two RNAi clones are shown.
ALPH1 RNAi depletion causes an increase in intact mRNA molecules, but no increase in decay intermediates
So far, the RNAi phenotypes of XRNA and ALPH1 are identical. Both are essential proteins and RNAi depletion causes an accumulation of deadenylated mRNAs, suggesting that both enzymes act downstream of deadenylation. However, if ALPH1 is the decapping enzyme, it should be involved in the initiation of mRNA decay, while XRNA is involved in the actual mRNA degradation process.
I have recently developed a method that enables to distinguish between these two enzyme functions [55]. Briefly, an endogenous very long mRNA (Tb427.01.1740) is used as a reporter to visualise mRNA degradation intermediates. The extreme 5’ and 3’ ends of this mRNA are simultaneously probed with a red and green fluorescent single molecule mRNA FISH probe (Affymetrix), respectively. This way, intact mRNA molecules appear as yellow spots, mRNAs in 5’-3’ decay are green and mRNAs in 3’-5’ decay or in transcription appear as red spots (Fig 4A). Due to the large size and short half-life of the reporter mRNA, there are only 21% of intact mRNAs, but 48% are in 3’-5’ decay [55]. RNAi depletion of XRNA for 48 hours resulted in a 5.6 fold increase in yellow spots and a 4.3 fold increase in green spots [55] (S4 Fig). Thus, a reduced level of XRNA does not only cause an increase in intact mRNA molecules, but also an increase in 5’-3’ decay intermediates; the most likely explanation for this is that XRNA is not 100% processive over the extreme length of the reporter mRNA. Any early release of XRNA from its substrate thus causes an increase in 5’-3’ decay intermediates because the time of decay-reinitiation is increased due to the shortage in XRNA molecules. In contrast to the RNAi phenotype of XRNA, RNAi depletion of any enzyme involved in the initiation of mRNA decay should cause an increase in intact mRNA molecules (yellow spots) only.
(A) Experimental design: The endogenous very long and short-lived mRNA Tb427.01.1740 was used as a reporter for mRNA metabolism [55]. Simultaneous probing of the extreme 5’ and 3’ ends with red and green fluorescent single mRNA FISH probes results in yellow, green or red fluorescent mRNA molecules, corresponding to intact mRNAs, mRNAs in 5’-3’ decay and mRNAs in transcription or 3’-5’ decay, respectively. (B) The numbers of yellow, green and red fluorescent spots were quantified from cells after induction of ALPH1 RNAi (0, 24 or 48 hours TET) from at least 130 cells per time-point, for three RNAi clones. Average data are shown; error bars represent the standard deviations between the different RNAi clones. The numbers of the differently coloured spots per total cell are shown (left), but also the numbers of spots in the nucleus (middle) or in the cytoplasm (right). If the centre of a spot was overlapping with the DAPI stained nucleus on a Z-stack projection image, the spot was defined as nuclear, otherwise as cytoplasmic. (C) Representative Z-stack projection images of untreated cells (no TET) and cells after 48 hours of ALPH1 RNAi (48 h TET).
To examine whether ALPH1 functions in mRNA decay initiation or mRNA degradation, cells were harvested over a time-course of ALPH1 RNAi and probed for the mRNA metabolism reporter Tb427.01.1740 [55]. The numbers of red, green and yellow spots were counted. There was a 1.5/3.5 fold increase in yellow spots (intact mRNA molecules) after 24/48 hours of RNAi induction, but no change in green or red spots (Fig 4B and 4C) (S5 Fig). The spots were further classified as either nuclear or cytoplasmic based on their co-localisation with the DAPI-stained nucleus on a Z-stack projection image. The increase in yellow spots was entirely due to an increase in cytoplasmic yellow spots (Fig 4B), as expected as a result of a decapping arrest.
These data now show a clear difference between the RNAi phenotypes of XRNA and ALPH1: depletion of XRNA RNAi results in an increase in both decay intermediates and intact mRNAs, while depletion of ALPH1 only causes an increase in intact mRNAs. The data suggest that ALPH1 acts upstream of XRNA in the initiation of mRNA decay, but downstream of deadenylation. The only known enzyme that fulfils these criteria is the decapping enzyme.
ALPH1 co-localises exclusively with XRNA to the posterior pole
As part of a screen, we have previously shown that TbALPH1 localises to both the posterior pole of the cell as well as to starvation stress granules and P-bodies [38]. A localisation to the posterior pole was previously observed only for XRNA but for no other proteins involved in mRNA metabolism [40].
To investigate a possible co-localisation between TbALPH1 and TbXRNA, I expressed ALPH1 with a C-terminal eYFP tag from the endogenous locus, together with XRNA-mChFP. Importantly, a C-terminally tagged ALPH1 is fully functional, as cell lines entirely dependent on the fusion protein could be obtained by deleting the second ALPH1 allele and showed no reduction in growth as well as the correct localization of the fusion protein (S6 Fig). As a control, I also co-expressed TbALPH1-eYFP with an N-terminal mChFP fusion of the DEAD box RNA helicase DHH1, a P-body marker protein that is absent from the posterior pole [40].
I observed full co-localisation between XRNA and ALPH1 to the posterior pole granule at heat shock as well as to both starvation stress granules and the posterior pole granule when cells were treated with PBS (Fig 5A and S7 Fig). In contrast, the co-localisation between ALPH1-eYFP and mChFP-DHH1 was only partial, as previously observed [38]. ALPH1 and DHH1 co-localised to P-bodies in untreated cells and to most starvation stress granules in starved cells (Fig 5B). DHH1 was absent from the posterior pole granule and ALPH1 was absent from some starvation stress granules, in particular from the ones localised closest to the posterior pole granule (Fig 5B and S8 and S9 Figs).
(A) Cells co-expressing XRNA-mChFP and ALPH1-eYFP from endogenous loci were treated with heat shock or starvation (PBS). The posterior pole granule is shown enlarged. (B) Cells co-expressing mChFP-DHH1 and ALPH1-eYFP from endogenous loci were treated with heat shock or starvation (PBS). The posterior pole granule (PP) is shown enlarged; for the PBS-treated cells the enlargement also includes the most posterior stress granule (SG) to show the absence of ALPH1.
The exclusive co-localisation between ALPH1 and XRNA is further evidence for both proteins being members of the same pathway.
Recombinant ALPH1ΔN sensitises the trypanosome SL RNA to yeast Xrn1 in vitro, but only after treatment with an RNA 5’ Polyphosphatase
The above data provide strong in vivo evidence for ALPH1 being the trypanosome decapping enzyme. To directly show the decapping activity in vitro, recombinant ALPH1 protein was purified from E. coli. The full length ALPH1 protein could not be expressed in a soluble form, and a truncated version lacking the N-terminal 221 amino acids (ALPH1ΔN) was therefore used. As a control, the same truncated version was expressed as an inactive mutant (Alph1ΔN*). For this, the highly conserved GDVHG motif involved in metal ion binding was mutated to GNVHG [56]. A Coomassie-stained gel with both purified proteins is shown in S10 Fig.
Next, the purified proteins were incubated with total trypanosome mRNA in the absence and presence of yeast Xrn1. If ALPH1 is the decapping enzyme, it should sensitise capped mRNAs to Xrn1. All RNA samples were analysed by northern blots probed for the capped SL RNA and, as a positive control, for the uncapped 5.8S rRNA (Fig 6). While the 5.8S rRNA disappeared in the presence of Xrn1, the ALPH1ΔN-treated SL RNA did not, indicating that ALPH1ΔN by itself does not produce RNA substrates for Xrn1 (Fig 6, lane 4). However, the addition of ALPH1ΔN, but not of the inactive Alph1ΔN* mutant, reproducibly caused a small band shift of the SL RNA that was absent in the similar-sized uncapped 5.8S rRNA (for example lane 3 and 4 in Fig 6). This indicated that ALPH1 targets the SL RNA, but without producing a substrate for Xrn1. One explanation is that ALPH1 does not produce a monophosphorylated mRNA, but a di- or triphosphorylated mRNA, which would be resistant to Xrn1 degradation. To test this, ALPH1-treated samples were treated with an RNA 5’ polyphosphatase (5’PP), which transforms tri- or diphosphorylated RNA into monophosphorylated RNA. When this phosphatase was included, subsequent Xrn1 treatment caused disappearance of the SL RNA band (Fig 6, lane 5). This was not observed with the catalytically inactive mutant Alph1ΔN* or with any other combinations of the enzymes (Fig 6, lanes 6–10). Thus, ALPH1 sensitises a capped RNA to yeast Xrn1 if an RNA 5’ polyphosphatase is included. This is consistent with ALPH1 being the decapping enzyme, producing a di- or triphosphorylated mRNA.
Total trypanosome mRNA was treated with recombinant ALPH1ΔN or Alph1ΔN* as indicated, purified, treated with RNA 5’ polyphosphatase as indicated, purified, and finally treated with yeast Xrn1 as indicated. The RNA samples were analysed by northern blot probed for the SL RNA (red) and the 5.8S rRNA (green). For lane 4–7 of replicate 1, an overexposed blot of the 5.8S rRNA is shown to demonstrate equal loading. Data of two representative replicates are shown, out of a total of four replicates.
No evidence for a function of TbDCP2 in decapping
Recently, one of the five trypanosome nudix domain proteins was renamed TbDCP2 because it has in vitro decapping activity [57]. The similarity to Dcp2 of other eukaryotes is low and the decapping activity is very poor, when the mRNA substrate had a type 4 cap [57]. Moreover, the protein was not purified with trypanosome RNA granules [38] and not identified as mRNA binding protein or protein involved in mRNA regulation in recent screens [39,58]. If TbDCP2 is responsible for the decapping of trypanosome mRNAs, its RNAi phenotype should resemble the RNAi phenotype of ALPH1. For three independent clonal cell lines, we found that RNAi depletion of TbDCP2 did not affect trypanosome growth, caused no increase in total mRNA levels and no change in the adenylation stage of the histone H4 mRNA (S11 Fig). Together, the data provide no evidence for TbDCP2 being the major trypanosome decapping enzyme and thus the functional orthologue to Dcp2.
Discussion
I show that the trypanosome ApaH-like phosphatase ALPH1 has all characteristics of an mRNA decapping enzyme. The enzyme is essential, localises to P-bodies and its depletion causes the accumulation of deadenylated mRNA molecules that have not yet started degradation. Its exclusive co-localisation with the 5’-3’ exoribonuclease XRNA suggests that both enzymes are members of the same pathway. Importantly, total mRNA levels increase to the same extent upon TbALPH1 and XRNA RNAi (compare Fig 2C and S2 Fig), ruling out that TbALPH1 only targets a small sub-group of mRNA molecules. In vitro experiments show that ALPH1ΔN, but not an inactive mutant of ALPH1 can sensitise the capped SL RNA to yeast Xrn1, as long as an RNA 5’ polyphosphatase is included. In contrast, depletion of the nudix domain protein TbDCP2 that was previously suggested to be the decapping enzyme, did not affect growth, mRNA levels or mRNA adenylation state. This is consistent with its in vitro activity being very low when a mature type 4 cap was used as a substrate [57]. I propose that TbALPH1 is the major trypanosome decapping enzyme and thus the functional orthologue to DCP2 of other eukaryotes.
The in vitro decapping experiments provide evidence for the decapping mechanism of ALPH1 being fundamentally different from the DCP2-mediated decapping. The data are consistent with ALPH1 leaving either a tri- or a diphosphate at the 5’ end of the decapped mRNA, instead of a monophosphate. A diphosphate is more likely than a triphosphate, as the bacterial ApaH protein cleaves phosphoanhydrid bonds rather than phosphoester bonds. In previous in vitro decapping assays using cell extracts of the Trypanosomatid Leptomonas, three products were released from an artificial RNA substrate with a type 0 cap: m7GDP, m7GMP and m7GpppG [29]. The release of m7GMP was interpreted as the result of a cap scavenger activity [29], the degradation of the cap structure after 3’-5’ exosomal decay [59]. However, more recent data provide little evidence for a cytoplasmic function of the trypanosome exosome [50] and it is possible that the detected m7GMP is in fact the product of ALPH1. It remains an unsolved question, how the uncapped, poly-phosphorylated mRNA is further degraded. One possibility is that the trypanosome 5’-3’ exoribonuclease, unlike yeast Xrn1, accepts poly-phosphorylated mRNAs as a substrate. If this is not the case, the trypanosome decapping complex must contain an RNA phosphatase that produces monophosphorylated mRNA substrates for XRNA. Notably, all in vitro experiments were performed with an N-terminally truncated ALPH1 protein. Thus, there also remains the possibility that the N-terminus of ALPH1 affects the catalytic mechanism.
To date, all reported decapping enzymes that act on intact mRNA caps are nudix domain proteins. This includes DCP2, long believed to be the only eukaryotic decapping enzyme, as well as the more recently discovered enzymes Nudt3 and Nudt16 that are responsible for decapping a subset of mRNAs in mammals [10,60–63]. Even in bacteria, mRNA decay is initiated by the nudix hydrolase RppH, which cleaves pyrophosphate from the mRNA’s 5’ terminal triphosphate [64]. Homologues to DCP2 are readily detectable in representative organisms of all major eukaryotic super-groups defined by [65]: Opisthokonta (yeast, human), Amoebozoa (Dictyostelium), Archaeplastida (Arabidopsis), SAR (Plasmodium), CCTH (Cryptophyta, Haptophyta) and Excavata (Naegleria, Trichomonas). Loss of DCP2 is selectively observed in (at least) two subgroups of the Excavata, the Euglenozoa (Kintoplastida and Euglena gracilis) and Fornicata (Giardia intestinalis and Spironucleus salmonicida). Only the kinetoplastid Perkinsela has a DCP2 homologue; it may be the product of a lateral gene transfer event as it has closest homology to DCP2 of plants and Perkinsela lacks all other components of the decapping complex. Does the loss of DCP2 correlate with the gain of ALPH1? All Kinetoplastida and Euglena do have a homologue of TbALPH1. The ALPH1 homologue of Euglena gracilis constitutes almost solely of the catalytic domain, but is still more similar to TbALPH1 than to TbALPH2 or TbALPH3. In contrast, neither Giardia intestinalis nor Spironucleus salmonicida has a homologue to TbALPH1. Thus, ALPH1 has replaced DCP2 in Euglenozoa, but Fornicata must compensate the absence of DCP2 in a different way. Notably, there are many eukaryotes that have ApaH like phosphatases in addition to a DCP2 homologue; these include eukaryotes of all branches, with the marked exception of vertebrates, insects or land plants [41,66]. The homology to ALPH1 is restricted to the catalytic domain and whether these are decapping enzymes, acting in addition to DCP2, or have evolved a different function, remains to be investigated. To my knowledge, no function of an ApaH-like phosphatase has yet been reported.
The described changes in mRNA decapping of Euglenozoa are not restricted to the replacement of DCP2 by an ApaH like phosphatase: the genomes of Kinetoplastids and Euglena gracilis also lack readily identifiable homologues to the decapping enhancers DCP1, EDC3 and Pat1. This indicates that the mechanistic differences between the mRNA decapping reactions of Euglenozoa and all other eukaryotes are major. Why have Euglenozoa evolved a mechanism for mRNA decapping that is fundamentally distinct to mRNA decapping present in the rest of the eukaryotes? SL RNA based trans-splicing cannot be responsible, as this is also present in several other eukaryotes that do have a DCP2 homologue, for example Nematodes and Dinoflagellates. However, to the best of my knowledge, only SL RNAs of Kinetoplastids have been found to be of the heavily methylated type 4. A recent publication shows that mammalian mRNAs that have a N6,2′-O-dimethyladenosine as the first nucleotide following the m7G cap are resistant to decapping by Dcp2 [67]; the corresponding nucleotide of the trypanosome type 4 cap is with three methyl groups even heavier methylated (Fig 1B). Thus, the unusual mRNA cap structure of Euglenozoa may require an unusual decapping enzyme.
Uniquely, a fraction of TbALPH1 and XRNA co-localise to a special granule at the posterior pole of the cell that is devoid of any other RNA binding proteins. I never observed any accumulation of mRNA degradation intermediates at the posterior pole (Fig 4 and [55], indicating that it is not the place of mRNA decay. I propose that instead, the granule separates the decay enzymes ALPH1 and XRNA from their mRNA targets and thus flexibly regulates the amount of mRNA decay as needed by the cell. The fraction of XRNA at the posterior pole is highly variable and depends on the cellular state of mRNA metabolism [40] and I found the same for ALPH1 (S. Kramer, manuscript in preparation).
ApaH-like phosphatases are present in all branches of the eukaryotic kingdom. With ALPH1, I report the first function for a eukaryotic ApaH-like phosphatase. In the absence of DCP2, Trypanosoma brucei, and possibly all Euglenoids use ALPH1 as their major mRNA decapping enzyme. This is an example of convergent evolution. TbALPH1 is essential, has no homologue in vertebrates and there is a crystal structure available for the closely related TbALPH3 [68]. These are some requirements for the employment of ALPH1 as a drug target against human diseases caused by Kinetoplastida, such as Leishmaniasis or Trypanosomiasis.
Material and methods
Trypanosomes
Trypanosoma brucei Lister 427 procyclic cells were used for most experiments. All RNAi- and overexpression experiments were done in Lister 427 pSPR2.1 cells that express a TET repressor [45]. RNAi or overexpression transcripts are under the control of a TET operator and expression is thus inducible with tetracycline. Cells were cultured in SDM-79 [69] at 27°C and 5% CO2. Transgenic trypanosomes were generated using standard procedures [70]. All experiments used logarithmically growing trypanosomes. For starvation, one volume of cells was washed once in one volume PBS and cultured for 2 hours in one volume PBS. Heat shock was done for two hours at 41°C either in a thermoblock or waterbath.
Plasmids and cloning
ALPH1 (SK335): ALPH1 open reading frame without stop codon in pJET1.2 (Thermo-Fisher Scientific) with N-terminal BspMI site to allow HindIII-compatible overhangs (sequence upstream of start codon: ACCTGCactAAGCTTCCGCCACC) and C-terminal BglII site (sequence downstream of last codon: GGTTCTagatctTGATCA) in frame to allow HindIII/BamHI compatible cloning into plasmids based on [71] or [45].
ALPH1 RNAi (SK309). The C-terminal 706 nts of the ALPH1 open reading frame were cloned head to head into p3666 [45].
XRNA RNAi (3862): as described in [50].
TbDCP2 RNAi (SK435). The C-terminal 698 nts of the DCP2 open reading frame were cloned head to head into p3666 [45].
CAF1 RNAi (SK431). The C-terminal 827 nts of the CAF1 open reading frame were cloned head to head into p3666 [45].
XRNA-mChFP, endogenous expression (SK346): The C-terminal 1107 nts of the XRNA ORF were cloned into p2705 [71]. The plasmid was linearized with NheI.
ΔALPH1 (SK390): A blasticidine resistance cassette was flanked by the 560 nts upstream of the ALPH1 ORF and 607 nts downstream of the ALPH1 ORF to allow deletion of ALPH1 by homologous recombination.
ALPH1-eYFP-4Ty1, endogenous expression (SK169): The C-terminal 706 nts of ALPH1 were cloned into SK141 [38], which is p2710 [71] with 4-Ty1 tags downstream of the eYFP. The plasmid was linearized with SalI. In the text, this plasmid is often referred to as ALPH1-eYFP to avoid confusion, as the Ty1 tag is not needed for the experiments shown here.
ALPH1-eYFP, endogenous expression (SK348): The C-terminal 706 nts of ALPH1 were cloned into p2948, which is p2710 [71] with a hygromycin resistance instead of neomycin resistance. This plasmid was used instead of SK169 to allow co-expression of ALPH1-eYFP with XRNA-mChFP (SK346). The plasmid was linearized with MscI.
mChFP-DHH1, endogenous expression (p2845): as described in [40].
His-ALPH1ΔN for bacterial expression (SK391): The ALPH1 open reading frame lacking the N-terminal 663 nucleotides was cloned into a modified pET15b plasmid for expression in E. coli. This resulted in IPTG inducible expression of an ALPH1ΔN protein with an N-terminal extension of MGSSHHHHHHSSGLVPRGSHMELYFQEASAT.
His-Alph1ΔN* for bacterial expression (SK468): As SK391, but the GDVHG encoding sequence was mutated to the GNVHG encoding sequence (D:N; GAC:AAC).
FISH experiments
Affmyetrix single molecule mRNA FISH was done as described previously [55] using the QuantiGene ViewRNA ISH Cell Assay (Affymetrix), protocol for glass slide format. Affymetrix probe sets were: ALPH1 (green, type 4): The N-terminal 1500 nts antisense to the ALPH1 ORF. DBP1 (red, type 1): the first 1260 nts antisense to the DBP1 ORF. CAF1 (red, type 1): antisense to the full ORF of CAF1. 5’ probe set (red, type 1, AF19): antisense to 288 nts upstream of the Tb427.01.1740 ORF followed by the first 812 nts of the ORF [55]. 3’ probe set (green, type 4): antisense to the last 656 nts of the Tb427.01.1740 ORF followed by the 444 nts downstream of the stop codon [55].
Microscopy
Z-stack images (100 stacks at 100 nm distance) were taken with a custom build TILL Photonics iMic microscope equipped with a sensicam camera (PCO), deconvolved using Huygens Essential software (Scientific Volume Imaging B. V., Hilversum, The Netherlands). All images are presented as Z-projections (method sum sliced) produced by ImageJ software. eYFP was monitored with the FRET-CFP/YFP-B-000 filter, mCherry and type 1 Affymetrix probes with the ET-mCherry-Texas-Red filter, type 4 Affymetrix probes with the ET-GFP filter and DNA with the DAPI filter (Chroma Technology CORP, Bellows Falls, VT).
Sequence analysis of ALPH1
The organisms used for the sequence analysis and alignments in Fig 1C were: Trypanosoma brucei TREU927, Trypanosoma brucei Lister strain 427, Trypanosoma evansi strain STIB 805, Trypanosoma brucei gambiense DAL 972, Trypanosoma congolense IL3000, Trypanosoma vivax Y486, Trypanosoma cruzi marinkellei strain B7, Trypanosoma cruzi Sylvio X10/1, Trypanosoma cruzi CL Brener Esmeraldo-like, Trypanosoma cruzi Dm28c, Trypanosoma cruzi CL Brener Non-Esmeraldo-like, Trypanosoma rangeli SC58, Trypanosoma grayi ANR4, Leptomonas seymouri ATCC 30220, Leishmania tarentolae Parrot-TarII, Leishmania sp. MAR LEM2494, Leishmania aethiopica L147, Leishmania tropica L590, Leishmania mexicana MHOM/GT/2001/U1103, Leishmania gerbilli strain LEM452. The ALPH1 sequence of Trypanosoma grayi ANR4 lacks the N-terminal domain, most likely due to a sequencing/database error; this organism was excluded from the N-terminal alignments.
Quantitative northern blots
Northern blots were done as previously described [40]. mRNA was prepared with the miRNeasy kit instead of the RNeasy kit (both Qiagen), if the detection of small RNAs (SL-RNA or 5.8S rRNA) was aimed. 18S rRNA and 5.8S rRNA were detected with antisense oligos coupled to IRDye 800, namely 5′ -CCTTCGCTGTAGTTCGTCTTGGTGCGGTCTAAGAATTTC-3′ and 5’-ACTTTGCTGCGTTCTTCAACGAAATAGGAAGCCAAGTC-3’, respectively. Total mRNA and SL RNA were detected by an oligo antisense to the miniexon sequence (5′-CAATATAGTACAGAAACTGTTCTA ATAATAGCGTT-3′), coupled to IRDye 700.
Blot images were collected with the Odyssey Infrared Imaging System (LI-COR Biosciences, Lincoln, NE) and quantified with ImageJ. The histone H4, GPI-PLC and PGKC probes were radioactively labelled DNAs of the entire ORFs; for the DCP2 probe the C-terminal 697 nts were used. Blot images were collected with a phosphorimager and analysed with ImageJ.
Decapping assays
For the first step (decapping), each 100 μl reaction contained 10 μl NEB buffer 3 (100 mM NaCl, 50 mM Tris-HCl, 10mM MgCl2, 1mM DTT, pH 7.9), 2 μl Ribolock (Thermo Fisher Scientific), 20 μg total trypanosome RNA prepared with the miRNeasy kit (Qiagen) and if required 2 or 20 μl recombinant ALPH1ΔN or Alph1ΔN* (corresponding to about 800 ng protein), respectively. After one hour incubation at 37°C, 200 μl water was added to increase the volume and the RNA was cleaned by extraction with 300 μl phenol and subsequent ethanol precipitation in the presence of 2 μl RNA grade glycogen (Thermo Fisher Scientific). The pellet was resuspended in the amount of water needed for the 20 μl reaction of the second step (RNA 5’ polyphosphatase treatment). To each reaction, 2 μl RNA 5’ polyphosphatase buffer (Epicentre) and 1 μl Ribolock were added and if required, 1 μl RNA 5’ polyphosphatase (Epicentre). After one hour incubation at 37°C, 280 μl water was added and the RNA was cleared and precipitated as above, but without adding additional glycogen.
The pellet was resuspended in the amount of water needed for the 100 μl reaction of the third step (Xrn1 treatment). To each reaction, 10 μl NEB buffer 3 and 2 μl Ribolock were added and, if required, 2 μl recombinant yeast Xrn1 (NEB). The samples were incubated at 37° for one hour and the RNA was cleared and precipitated as above. The pellet was resuspended in 6 μl water and the entire sample was analysed by northern blot.
Production of recombinant ALPH1
One litre of RosettaBlue competent bacteria cells (Novagen) carrying the plasmids SK391 or SK468 was started from an over night culture. At an OD of 0.8, protein expression was induced with 0.02% Isopropyl-β-D-thiogalactopyranosid (IPTG) for 2 hours. Cells were harvested (15 min, 10.000 g), resuspended in 40 ml buffer A (300 mM NaCl, 50 mM NaH2PO4, pH 8) and disrupted by ultrasonication (Sonifier B-12, Branson). The non-soluble material was pelleted by centrifugation (15 min, 20.000 g) and the soluble material (supernatant) was incubated with 3 ml Nickel-NTA agarose (Qiagen) equilibrated in buffer A for 60 min while rotating. The agarose was washed 3 times for 5 min in 50 ml buffer A and poured into a 2 ml Pierce centrifuge column. For washing, the column was loaded successively with 5 ml buffer A, 5 ml 10 mM imidazole and 5 ml 20 mM imidazole. Elution was done in two steps with 5 ml 100 mM imidazole and 5 ml 250 mM imidazole. Both eluates were rebuffered into PBS with PD10 columns (GE healthcare). The majority of the proteins eluted with 100 mM imidazole, but the 250 mM eluate contained less contaminants and was therefore used for the enzyme assays.
RNAse H experiment
4 μg total RNA was incubated with or without 2 μl oligo (dT) (100 μM) in 16 μl volume at 65°C for 10 minutes. After slowly cooling down to room temperature, 2 μl RNAse H buffer, 1 μl Ribolock (ThermoScientific) and 1 μl RNAse H (NEB) or water (control) was added. The reactions were incubated at 37°C for one hour. RNA was purified by phenol-extraction followed by ethanol precipitation in the presence of 1 μl glycogen and 1 μl tRNA (25 mg/ml). RNA pellets were resuspended in 6 μl water for northern blot analysis.
Supporting information
S1 Fig. Alignment of the protein sequences of TbALPH1, TbALPH2 and TbALPH3.
https://doi.org/10.1371/journal.ppat.1006456.s001
(PDF)
S2 Fig. Increase in total mRNAs after tetracycline (TET) inducible RNAi depletion of XRNA.
https://doi.org/10.1371/journal.ppat.1006456.s002
(PDF)
S3 Fig. RNAi depletion of CAF1.
Three independent clonal cell lines were analysed over a time-course of RNAi induction.
https://doi.org/10.1371/journal.ppat.1006456.s003
(PDF)
S4 Fig. mRNA decay was monitored after 0 and 48 hours of XRNA RNAi (field view image).
https://doi.org/10.1371/journal.ppat.1006456.s004
(PDF)
S5 Fig. mRNA decay was monitored after 0 and 48 hours of ALPH1 RNAi (field view image).
https://doi.org/10.1371/journal.ppat.1006456.s005
(PDF)
S6 Fig. A cell line entirely dependent on Tbalph1-eYFP4Ty1 is viable.
https://doi.org/10.1371/journal.ppat.1006456.s006
(PDF)
S7 Fig. Starved cells co-expressing XRNA-mChFP and ALPH1-eYFP from endogenous loci (field view image).
https://doi.org/10.1371/journal.ppat.1006456.s007
(PDF)
S8 Fig. Starved cells co-expressing mChFP-DHH1 and ALPH1-eYFP from endogenous loci (field view image).
https://doi.org/10.1371/journal.ppat.1006456.s008
(PDF)
S9 Fig. Examples images of starved cells co-expressing ALPH1-eYFP and mChFP-DHH1 from the endogenous locus.
https://doi.org/10.1371/journal.ppat.1006456.s009
(PDF)
S10 Fig. Coomassie-stained gel of the purified proteins ALPH1ΔN and Alph1ΔN*.
https://doi.org/10.1371/journal.ppat.1006456.s010
(PDF)
S12 Fig. RNAi depletion of ALPH1: The reduction in ALPH1 RNA molecules was quantified by single molecule RNA FISH from a second clone.
https://doi.org/10.1371/journal.ppat.1006456.s012
(PDF)
Acknowledgments
The author thanks Carina Goos (University of Würzburg Germany) for discussions and help with the figures and the manuscript, Nancy Standard (University of Cambridge, UK) for discussions and suggestions on the project, Mark Carrington (University of Cambridge, UK) for discussions and plasmids, Keith Gull (University of Oxford, UK) for providing Trypanosoma brucei Lister 427 procyclic cells and the BB2 antibody, Nina Scheffler (University of Würzburg Germany) for help with the TbDCP2 project and Markus Engstler (University of Würzburg, Germany) for providing lab space and mentoring.
References
- 1. Decker CJ, Parker R. P-bodies and stress granules: possible roles in the control of translation and mRNA degradation. Cold Spring Harb Perspect Biol. 2012 Sep;4(9):a012286. pmid:22763747
- 2. Courchaine EM, Lu A, Neugebauer KM. Droplet organelles? EMBO J. 2016 Jun 29;:e201593517.
- 3. Kramer S. RNA in development: how ribonucleoprotein granules regulate the life cycles of pathogenic protozoa. WIREs RNA. 2014 Mar;5(2):263–84. pmid:24339376
- 4. Lykke-Andersen J. Identification of a Human Decapping Complex Associated with hUpf Proteins in Nonsense-Mediated Decay. Mol Cell Biol. 2002 Dec 1;22(23):8114–21. pmid:12417715
- 5. Steiger M, Carr-Schmid A, Schwartz DC, Kiledjian M, Parker R. Analysis of recombinant yeast decapping enzyme. RNA. 2003 Feb;9(2):231–8. pmid:12554866
- 6. van Dijk E, Cougot N, Meyer S, Babajko S, Wahle E, Séraphin B. Human Dcp2: a catalytically active mRNA decapping enzyme located in specific cytoplasmic structures. EMBO J. 2002 Dec 16;21(24):6915–24. pmid:12486012
- 7. Wang Z, Jiao X, Carr-Schmid A, Kiledjian M. The hDcp2 protein is a mammalian mRNA decapping enzyme. Proc Natl Acad Sci USA. 2002 Oct 1;99(20):12663–8. pmid:12218187
- 8. Deshmukh MV, Jones BN, Quang-Dang D-U, Flinders J, Floor SN, Kim C, et al. mRNA decapping is promoted by an RNA-binding channel in Dcp2. Mol Cell. 2008 Feb 15;29(3):324–36. pmid:18280238
- 9. She M, Decker CJ, Svergun DI, Round A, Chen N, Muhlrad D, et al. Structural basis of dcp2 recognition and activation by dcp1. Mol Cell. 2008 Feb 15;29(3):337–49. pmid:18280239
- 10. Grudzien-Nogalska E, Kiledjian M. New insights into decapping enzymes and selective mRNA decay. WIREs RNA. 2016 Jul 17.
- 11. Nissan T, Rajyaguru P, She M, Song H, Parker R. Decapping Activators in Saccharomyces cerevisiae Act by Multiple Mechanisms. Mol Cell. 2010 Sep 10;39(5):773–83. pmid:20832728
- 12. Harigaya Y, Jones BN, Muhlrad D, Gross JD, Parker R. Identification and analysis of the interaction between Edc3 and Dcp2 in Saccharomyces cerevisiae. Mol Cell Biol. 2010 Mar;30(6):1446–56. pmid:20086104
- 13. Chowdhury A, Mukhopadhyay J, Tharun S. The decapping activator Lsm1p-7p-Pat1p complex has the intrinsic ability to distinguish between oligoadenylated and polyadenylated RNAs. RNA. 2007 Jul;13(7):998–1016. pmid:17513695
- 14. Presnyak V, Coller J. The DHH1/RCKp54 family of helicases: an ancient family of proteins that promote translational silencing. Biochim Biophys Acta. 2013 Aug;1829(8):817–23. pmid:23528737
- 15. Marnef A, Sommerville J, Ladomery MR. RAP55: insights into an evolutionarily conserved protein family. Int J Biochem Cell Biol. 2009 May 1;41(5):977–81. pmid:18723115
- 16. Parker R. RNA degradation in Saccharomyces cerevisae. Genetics. 2012 Jul;191(3):671–702. pmid:22785621
- 17. Dunckley T, Parker R. The DCP2 protein is required for mRNA decapping in Saccharomyces cerevisiae and contains a functional MutT motif. EMBO J. 1999 Oct 1;18(19):5411–22. pmid:10508173
- 18. Xu J, Yang JY, Niu QW, Chua NH. Arabidopsis DCP2, DCP1, and VARICOSE Form a Decapping Complex Required for Postembryonic Development. Plant Cell. 2006 Dec 8;18(12):3386–98. pmid:17158604
- 19. López-Rosas I, Orozco E, Marchat LA, García-Rivera G, Guillen N, Weber C, et al. mRNA decay proteins are targeted to poly(A)+ RNA and dsRNA-containing cytoplasmic foci that resemble P-bodies in Entamoeba histolytica. PLoS ONE. 2012;7(9):e45966. pmid:23029343
- 20. Williams CW, Elmendorf HG. Identification and analysis of the RNA degrading complexes and machinery of Giardia lambliausing an in silico approach. BMC Genomics. BioMed Central Ltd; 2011 Nov 29;12(1):586.
- 21. Aslett M, Aurrecoechea C, Berriman M, Brestelli J, Brunk BP, Carrington M, et al. TriTrypDB: a functional genomic resource for the Trypanosomatidae. Nucleic Acids Res. 2010;38(Database issue):D457–62. pmid:19843604
- 22. Liu Q, Liang X-H, Uliel S, Belahcen M, Unger R, Michaeli S. Identification and functional characterization of lsm proteins in Trypanosoma brucei. J Biol Chem. 2004 Apr 30;279(18):18210–9. pmid:14990572
- 23. Tkacz ID, Cohen S, Salmon-Divon M, Michaeli S. Identification of the heptameric Lsm complex that binds U6 snRNA in Trypanosoma brucei. Mol Biochem Parasitol. 2008 Jul 1;160(1):22–31. pmid:18433897
- 24. Holetz FB, Alves LR, Probst CM, Dallagiovanna B, Marchini FK, Manque P, et al. Protein and mRNA content of TcDHH1-containing mRNPs in Trypanosoma cruzi. FEBS J. 2010 Jul 12.
- 25. Kramer S, Queiroz R, Ellis L, Hoheisel JD, Clayton CE, Carrington M. The RNA helicase DHH1 is central to the correct expression of many developmentally regulated mRNAs in trypanosomes. J Cell Sci. 2010 Mar 1;123(Pt 5):699–711. pmid:20124414
- 26. Holetz FB, Correa A, Avila AR, Nakamura CV, Krieger MA, Goldenberg S. Evidence of P-body-like structures in Trypanosoma cruzi. Biochem Biophys Res Commun. 2007 May 18;356(4):1062–7. pmid:17399688
- 27. Krüger T, Hofweber M, Kramer S. SCD6 induces ribonucleoprotein granule formation in trypanosomes in a translation-independent manner, regulated by its Lsm and RGG domains. Mol Biol Cell. 2013 Jul;24(13):2098–111. pmid:23676662
- 28. Cristodero M, Schimanski B, Heller M, Roditi I. Functional characterization of the trypanosome translational repressor SCD6. Biochem J. 2014 Jan 1;457(1):57–67. pmid:24087925
- 29. Milone J, Wilusz J, Bellofatto V. Identification of mRNA decapping activities and an ARE-regulated 3”to 5” exonuclease activity in trypanosome extracts. Nucleic Acids Res. 2002 Sep 15;30(18):4040–50. pmid:12235388
- 30. Preusser C, Jaé N, Bindereif A. mRNA splicing in trypanosomes. Int J Med Microbiol. 2012 Oct;302(4–5):221–4. pmid:22964417
- 31. Bangs JD, Crain PF, Hashizume T, McCloskey JA, Boothroyd JC. Mass spectrometry of mRNA cap 4 from trypanosomatids reveals two novel nucleosides. J Biol Chem. 1992 May 15;267(14):9805–15. pmid:1349605
- 32. Perry KL, Watkins KP, Agabian N. Trypanosome mRNAs have unusual “cap 4” structures acquired by addition of a spliced leader. Proc Natl Acad Sci USA. 1987 Dec;84(23):8190–4. pmid:3120186
- 33. Estevez AM, Kempf T, Clayton CE. The exosome of Trypanosoma brucei. EMBO J. 2001 Jul 16;20(14):3831–9. pmid:11447124
- 34. Li C- H, Irmer H, Gudjonsdottir-Planck D, Freese S, Salm H, Haile S, et al. Roles of a Trypanosoma brucei 5“->3” exoribonuclease homolog in mRNA degradation. RNA. 2006 Dec 1;12(12):2171–86. pmid:17077271
- 35. Manful T, Fadda A, Clayton CE. The role of the 5“-3” exoribonuclease XRNA in transcriptome-wide mRNA degradation. RNA. 2011 Nov 1;17(11):2039–47. pmid:21947264
- 36. Schwede A, Ellis L, Luther J, Carrington M, Stoecklin G, Clayton CE. A role for Caf1 in mRNA deadenylation and decay in trypanosomes and human cells. Nucleic Acids Res. 2008 Jun 1;36(10):3374–88. pmid:18442996
- 37. Erben E, Chakraborty C, Clayton CE. The CAF1-NOT complex of trypanosomes. Front Genet. 2014;4:299. pmid:24427169
- 38. Fritz M, Vanselow J, Sauer N, Lamer S, Goos C, Siegel TN, et al. Novel insights into RNP granules by employing the trypanosome's microtubule skeleton as a molecular sieve. Nucleic Acids Res. 2015 Sep 18;43(16):8013–32. pmid:26187993
- 39. Lueong S, Merce C, Fischer B, Hoheisel JD, Erben ED. Gene expression regulatory networks in Trypanosoma brucei: insights into the role of the mRNA-binding proteome. Mol Microbiol. 2016 Mar 10;100(3):457–71. pmid:26784394
- 40. Kramer S, Queiroz R, Ellis L, Webb H, Hoheisel JD, Clayton CE, et al. Heat shock causes a decrease in polysomes and the appearance of stress granules in trypanosomes independently of eIF2(alpha) phosphorylation at Thr169. J Cell Sci. 2008 Sep 15;121(Pt 18):3002–14. pmid:18713834
- 41. Andreeva AV, Kutuzov MA. Widespread presence of “bacterial-like” PPP phosphatases in eukaryotes. BMC Evol Biol. 2004 Nov 19;4:47. pmid:15555063
- 42. Brenchley R, Tariq H, McElhinney H, Szöor B, Huxley-Jones J, Stevens R, et al. The TriTryp phosphatome: analysis of the protein phosphatase catalytic domains. BMC Genomics. 2007;8:434. pmid:18039372
- 43. Koonin EV. Bacterial and bacteriophage protein phosphatases. Mol Microbiol. 1993 May;8(4):785–6. pmid:8392657
- 44. Barton GJ, Cohen PT, Barford D. Conservation analysis and structure prediction of the protein serine/threonine phosphatases. Sequence similarity with diadenosine tetraphosphatase from Escherichia coli suggests homology to the protein phosphatases. Eur J Biochem. 1994 Feb 15;220(1):225–37. pmid:8119291
- 45. Sunter J, Wickstead B, Gull K, Carrington M. A new generation of T7 RNA polymerase-independent inducible expression plasmids for Trypanosoma brucei. PLoS ONE. 2012;7(4):e35167. pmid:22511983
- 46. Carrington M, Bülow R, Reinke H, Overath P. Sequence and expression of the glycosyl-phosphatidylinositol-specific phospholipase C of Trypanosoma brucei. Mol Biochem Parasitol. 1989 Mar 15;33(3):289–96. pmid:2523022
- 47. Mensa-Wilmot K, Hereld D, Englund PT. Genomic organization, chromosomal localization, and developmentally regulated expression of the glycosyl-phosphatidylinositol-specific phospholipase C of Trypanosoma brucei. Mol Cell Biol. 1990 Feb;10(2):720–6. pmid:1688997
- 48. Osinga KA, Swinkels BW, Gibson WC, Borst P, Veeneman GH, Van Boom JH, et al. Topogenesis of microbody enzymes: a sequence comparison of the genes for the glycosomal (microbody) and cytosolic phosphoglycerate kinases of Trypanosoma brucei. EMBO J. 1985 Dec 30;4(13B):3811–7. pmid:3004970
- 49. Gibson WC, Swinkels BW, Borst P. Post-transcriptional control of the differential expression of phosphoglycerate kinase genes in Trypanosoma brucei. J Mol Biol. 1988 May 20;201(2):315–25. pmid:2458474
- 50. Kramer S, Piper S, Estevez AM, Carrington M. Polycistronic trypanosome mRNAs are a target for the exosome. Mol Biochem Parasitol. 2016 Mar 3;205(1–2):1–5. pmid:26946399
- 51. Fadda A, Ryten M, Droll D, Rojas F, Färber V, Haanstra JR, et al. Transcriptome-wide analysis of trypanosome mRNA decay reveals complex degradation kinetics and suggests a role for co-transcriptional degradation in determining mRNA levels. Mol Microbiol. 2014 Oct;94(2):307–26. pmid:25145465
- 52. Muhlrad D, Decker CJ, Parker R. Deadenylation of the unstable mRNA encoded by the yeast MFA2 gene leads to decapping followed by 5“—>3” digestion of the transcript. Genes Dev. 1994 Apr 1;8(7):855–66. pmid:7926773
- 53. Beelman CA, Stevens A, Caponigro G, LaGrandeur TE, Hatfield L, Fortner DM, et al. An essential component of the decapping enzyme required for normal rates of mRNA turnover. Nature. 1996 Aug 15;382(6592):642–6. pmid:8757137
- 54. Boeck R, Lapeyre B, Brown CE, Sachs AB. Capped mRNA degradation intermediates accumulate in the yeast spb8-2 mutant. Mol Cell Biol. 1998 Sep;18(9):5062–72. pmid:9710590
- 55. Kramer S. Simultaneous detection of mRNA transcription and decay intermediates by dual colour single mRNA FISH on subcellular resolution. Nucleic Acids Res. 2016 Dec 9;45(7):e49.
- 56. Ogris E, Mudrak I, Mak E, Gibson D, Pallas DC. Catalytically inactive protein phosphatase 2A can bind to polyomavirus middle tumor antigen and support complex formation with pp60(c-src). J Virol. 1999 Sep;73(9):7390–8. pmid:10438829
- 57. Ignatochkina AV, Takagi Y, Liu Y, Nagata K, Ho CK. The messenger RNA decapping and recapping pathway in Trypanosoma. Proc Natl Acad Sci USA. 2015 Jun 2;112(22):6967–72. pmid:26038549
- 58. Erben ED, Fadda A, Lueong S, Hoheisel JD, Clayton CE. A genome-wide tethering screen reveals novel potential post-transcriptional regulators in Trypanosoma brucei. PLoS Pathog. 2014 Jun;10(6):e1004178. pmid:24945722
- 59. Wang Z, Kiledjian M. Functional link between the mammalian exosome and mRNA decapping. Cell. 2001 Dec 14;107(6):751–62. pmid:11747811
- 60. Grudzien-Nogalska E, Jiao X, Song M-G, Hart RP, Kiledjian M. Nudt3 is an mRNA decapping enzyme that modulates cell migration. RNA. 2016 Apr 18;22(5):773–81. pmid:26932476
- 61. Song M- G, Li Y, Kiledjian M. Multiple mRNA decapping enzymes in mammalian cells. Mol Cell. 2010 Nov 12;40(3):423–32. pmid:21070968
- 62. Song M- G, Bail S, Kiledjian M. Multiple Nudix family proteins possess mRNA decapping activity. RNA. 2013 Mar;19(3):390–9. pmid:23353937
- 63. Lu G, Zhang J, Li Y, Li Z, Zhang N, Xu X, et al. hNUDT16: a universal decapping enzyme for small nucleolar RNA and cytoplasmic mRNA. Protein Cell. Higher Education Press; 2011 Jan;2(1):64–73. pmid:21337011
- 64. Deana A, Celesnik H, Belasco JG. The bacterial enzyme RppH triggers messenger RNA degradation by 5' pyrophosphate removal. Nature. 2008 Jan 17;451(7176):355–8. pmid:18202662
- 65. Adl SM, Simpson AGB, Lane CE, Lukes J, Bass D, Bowser SS, et al. The revised classification of eukaryotes. J Eukaryot Microbiol. 2012 Sep;59(5):429–93. pmid:23020233
- 66. Uhrig RG, Kerk D, Moorhead GB. Evolution of bacterial-like phosphoprotein phosphatases in photosynthetic eukaryotes features ancestral mitochondrial or archaeal origin and possible lateral gene transfer. Plant Physiol. American Society of Plant Biologists; 2013 Dec;163(4):1829–43. pmid:24108212
- 67. Mauer J, Luo X, Blanjoie A, Jiao X, Grozhik AV, Patil DP, et al. Reversible methylation of m. Nature. Nature Publishing Group; 2017 Jan 19;541(7637):371–5. pmid:28002401
- 68. Almo SC, Bonanno JB, Sauder JM, Emtage S, Dilorenzo TP, Malashkevich V, et al. Structural genomics of protein phosphatases. J Struct Funct Genomics. 2007 Sep;8(2–3):121–40. pmid:18058037
- 69. Brun R, Schönenberger . Cultivation and in vitro cloning or procyclic culture forms of Trypanosoma brucei in a semi-defined medium. Short communication. Acta Trop. 1979 Sep;36(3):289–92. pmid:43092
- 70. McCulloch R, Vassella E, Burton P, Boshart M, Barry JD. Transformation of monomorphic and pleomorphic Trypanosoma brucei. Methods Mol Biol. 2004;262:53–86. pmid:14769956
- 71. Kelly S, Reed J, Kramer S, Ellis L, Webb H, Sunter J, et al. Functional genomics in Trypanosoma brucei: a collection of vectors for the expression of tagged proteins from endogenous and ectopic gene loci. Mol Biochem Parasitol. 2007 Jul 1;154(1):103–9. pmid:17512617
- 72. Zhang J, Zhang Z, Brew K, Lee EY. Mutational analysis of the catalytic subunit of muscle protein phosphatase-1. Biochemistry. 1996 May 21;35(20):6276–82. pmid:8639569