Complete output

Complete outputComplete output

Protein Group 1

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
2608	175	45	34	41

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
484	1051.45	2100.88	2100.04	56	ALASQALSIFGDHQDVMAAR	biorepCdiff_7
382	1059.27	2116.52	2116.04	50	ALASQALSIFGDHQDVMAAR +Oxidation (M)	37_8
281	891.98	1781.95	1781.83	70	ATYLIDEADYIACHK	37A_8
36	481.35	960.69	960.54	28	DFILAQVR	biorepCdiffA_8
105	528.88	1055.74	1056.54	37	ENAPMIIGGR	37_8
258	767.03	1532.04	1531.75	72	EPGSTGEPLYLDVR	37_8
2	403.26	804.51	804.41	32	FGDTPIR	37A_8
55	471.29	940.56	940.50	33	FYTVNAVK	37A_7
472	1335.72	2669.42	2669.17	60	GPSWANSLFEDNAEYGFGMYTAVK +Oxidation (M)	37A_8
312	756.01	1510.01	1509.72	60	GTAQNPDIYFQTR	37_7
226	702.00	1401.99	1401.67	44	HFLDAMPSTVER	37_8
235	709.98	1417.95	1417.67	44	HFLDAMPSTVER +Oxidation (M)	37_8
226	758.40	1514.78	1514.67	70	HSLFDYYGAEDAK	37A_8
551	1168.80	2335.58	2335.01	75	IQVSPLDCTGCGNCADICPAK	37_7
362	1020.77	2039.53	2038.93	64	IVDAMTELVSMDICEDAK	37_8
370	1036.72	2071.42	2070.92	73	IVDAMTELVSMDICEDAK +2 Oxidation (M)	37_8
367	1028.82	2055.62	2054.92	90	IVDAMTELVSMDICEDAK +Oxidation (M)	37_8
347	938.77	1875.53	1874.99	97	IVNMNYAAVDAGINALVK	biorepCdiff_8
415	946.70	1891.39	1890.99	76	IVNMNYAAVDAGINALVK +Oxidation (M)	37_7
277	822.56	1643.11	1642.76	87	KHSLFDYYGAEDAK	biorepCdiff_8
285	663.94	1325.88	1325.71	47	LAEIIPEEDAVK	37A_1
131	528.89	1055.77	1055.57	59	LGQEIGLGNR	37_7
197	466.03	1395.08	1394.71	39	LPFIHFFDGFR	biorepCdiff_8
566	1202.88	2403.74	2403.22	63	NGFTVGIVDDVTNTSLTPSEPIK	37_7
583	1305.00	3911.98	3911.85	43	NILRPMTAQEGNNLPVSTFNGIEDGTFPCGTAAYEK	37A_8
73	461.31	920.61	920.46	42	NPFTLDSK	37_8
202	676.51	1351.01	1350.65	34	QFPEEADGLFAK	biorepCdiff_7
401	1095.20	2188.38	2188.96	71	QPLMEFSGACAGCGETAYIK	37_8
406	736.16	2205.47	2204.95	69	QPLMEFSGACAGCGETAYIK +Oxidation (M)	37_8
73	529.77	1057.53	1057.53	63	SGGITMSHLR	37A_8
81	537.81	1073.61	1073.53	45	SGGITMSHLR +Oxidation (M)	37A_8
373	881.65	1761.29	1760.89	115	TKEPGSTGEPLYLDVR	37_7
340	1055.14	2108.26	2107.99	83	TVANEAQAVACGYWHLYR	37A_8
193	688.97	1375.93	1375.70	39	TVFDNLVSEQPK	37A_8
261	518.27	1551.79	1550.86	38	VAGELLPGVFHVSAR	biorepCdiff_8
112	537.46	1072.90	1072.56	28	VDVMPANTVK	biorepCdiff_7
140	545.34	1088.67	1088.55	37	VDVMPANTVK +Oxidation (M)	37_7
451	1285.77	2569.52	2569.27	96	VELLENEDYASLLNFEAVQAFR	37A_8
282	815.53	1629.05	1628.77	62	VEVPASWENAVDADK	37_8
178	647.44	1292.87	1292.67	28	VHLYRPFSMK +Oxidation (M)	37_8
307	953.67	1905.33	1904.89	55	VVELLEKPACDCTDEK	37A_8
130	525.82	1049.63	1049.55	49	VVTQLYGDR	37_7
191	685.84	1369.66	1369.58	69	YAQAYFDYDSK	37A_8
223	749.89	1497.77	1497.68	52	YAQAYFDYDSKK	37A_8
231	663.94	1325.87	1324.70	64	YYQNIVGIVEK	37_7

Matching Genes:

gi|115251733|emb|CAJ69568.1| (pyruvate-flavodoxin oxidoreductase [Clostridium difficile 630])

Protein Group 2

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
1442	70	22	20	42

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
457	680.76	2039.24	2038.93	92	AAQEQQAAQGAEQAQDNGPK	37_7
662	1053.85	3158.54	3157.42	39	AAQEQQAAQGAEQAQDNGPKDDNVVDADFK	37_7
302	927.06	1852.11	1851.80	67	DDNVVDADFKEVDEDK	37A_7
257	681.42	1360.83	1360.65	62	DNQDATAEELKK	37_7
484	1065.30	2128.58	2128.03	82	EKIEAFNQAESTIYQTEK	37_7
567	1204.92	2407.83	2407.19	92	ELSSTMSSNINLPFITATAEGPK	37_7
575	1212.87	2423.72	2423.19	57	ELSSTMSSNINLPFITATAEGPK +Oxidation (M)	37_7
100	484.34	966.66	966.52	47	HLNIDLSR	37_7
410	936.67	1871.32	1870.89	95	IEAFNQAESTIYQTEK	37_7
265	839.66	1677.31	1676.84	61	IINEPTAAALAYGMDK	37A_7
366	847.61	1693.21	1692.84	60	IINEPTAAALAYGMDK +Oxidation (M)	37_7
59	477.88	953.75	953.55	46	IPAVQEAVK	37A_7
138	541.90	1081.79	1081.65	29	IPAVQEAVKK	37_7
178	617.89	1233.76	1233.61	66	ISSGEKEDIEK	37_7
413	946.17	1890.33	1889.96	109	ITITSNTNLSEAEIEQK	37_7
639	978.40	2932.16	2931.41	63	SDAESYLGQTVTEAVITVPAYFTDAQR	37_7
588	1250.81	2499.60	2499.24	106	SQIFSTAADNQTAVDIHVLQGER	37_7
340	796.16	1590.31	1589.87	43	SYTPQEISAIILQK	37_7
435	1187.87	2373.72	2373.20	85	TALQDAGLSTGDIDDVLLVGGSTR	37A_7
70	445.29	888.56	888.46	54	TLNELGDK	37_7
82	525.83	1049.65	1049.58	45	TTPSVVAFTK	37A_7
119	506.79	1011.57	1011.47	42	VSQEMYQK	37_7

Matching Genes:

gi|115251515|emb|CAJ69348.1| (chaperone protein [Clostridium difficile 630])

Protein Group 3

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
1386	54	26	21	44

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
492	1086.38	2170.74	2170.04	59	ATYTMIFDHYEQVPASVAK	37_7
497	1094.32	2186.62	2186.04	65	ATYTMIFDHYEQVPASVAK +Oxidation (M)	37_7
566	1297.60	3889.77	3888.85	28	DTTTGDTLCDPANPIILESMEFPEPVISVAIEPSSK +Oxidation (M)	37A_7
259	681.98	1361.95	1361.74	60	EDSFIGIIDLLK	37_7
172	679.43	1356.85	1356.64	64	GGVEPQSENVWR	37A_7
155	580.35	1158.68	1158.55	53	GILADGEEAER	37_7
234	783.08	1564.15	1563.72	53	HSSDEEPFSALAFK	37A_7
509	713.51	2137.51	2136.87	39	IGETHEGASQMDWMEQEK +2 Oxidation (M)	biorepCdiff_7
449	808.46	2422.35	2422.02	30	IGETHEGASQMDWMEQEKER +2 Oxidation (M)	37A_7
110	604.38	1206.74	1206.64	42	ILFYTGQTHK	37A_7
85	542.34	1082.66	1082.57	38	ILQMHANTR	37A_7
75	512.28	1022.54	1022.51	39	IMTDPFVGK +Oxidation (M)	37A_7
124	625.39	1248.77	1248.62	71	LAEEDPTFTVK	37A_7
208	741.49	1480.97	1480.81	50	LNSNAVPMQLPIGK	37A_7
307	749.52	1497.02	1496.80	49	LNSNAVPMQLPIGK +Oxidation (M)	37_7
281	878.53	1755.05	1754.80	47	LVESVAETDEELMMK +2 Oxidation (M)	37A_7
74	510.82	1019.63	1019.50	42	QAETYGVPR	37A_7
592	835.00	2501.98	2501.23	83	SGAQVINAFVPLSEMFGYSTDLR	37_7
595	1259.92	2517.83	2517.22	54	SGAQVINAFVPLSEMFGYSTDLR +Oxidation (M)	37_7
157	587.85	1173.69	1173.57	55	VAPQEPGEGYK	37_7
528	1129.79	2257.56	2256.99	41	VEVVTPEDYMGDVMGDLNSR +2 Oxidation (M)	37_7
521	1121.81	2241.61	2240.99	42	VEVVTPEDYMGDVMGDLNSR +Oxidation (M)	37_7
60	480.87	959.72	959.52	45	VGAPQVAYR	37A_7
192	624.47	1246.92	1246.69	71	VYAGDIAAAVGLK	37_7
376	895.15	1788.29	1787.89	101	VYSGTLESGSYVLNATK	37_7
230	776.55	1551.09	1550.77	65	YLEGEELTIDELK	37A_7

Matching Genes:

gi|115249074|emb|CAJ66885.1| (translation elongation factor G [Clostridium difficile 630])

Protein Group 4

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
1353	106	21	19	54

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
92	498.32	994.62	994.52	67	AEAHIQAGAK	biorepCdiff_5
86	505.83	1009.65	1009.65	63	AIGLVIPSLK	37A_4
128	619.91	1237.81	1237.64	77	DKAEAHIQAGAK	37_5
294	718.08	1434.15	1433.74	53	FEVVAINDLTDAK	biorepCdiff_5
66	468.26	934.50	934.48	60	FNGEIEVK	37A_4
584	808.91	2423.70	2423.15	62	GLMTTIHAYTNDQNTLDGPHPK	37_6
502	814.10	2439.28	2439.15	36	GLMTTIHAYTNDQNTLDGPHPK +Oxidation (M)	37A_4
255	649.98	1297.94	1297.76	67	KVVISAPATGDLK	37_4
23	430.28	858.54	858.48	30	MLAHLFK	37A_5
474	1163.34	2324.67	2324.10	98	MMEQQDKFEVVAINDLTDAK	37_5
582	1179.31	2356.61	2356.09	73	MMEQQDKFEVVAINDLTDAK +2 Oxidation (M)	37_4
476	1171.28	2340.55	2340.10	84	MMEQQDKFEVVAINDLTDAK +Oxidation (M)	37_5
508	927.52	2779.55	2778.36	75	NPADLPWAELGVDIVLECTGFFTSK	biorepCdiffA_1
211	659.86	1317.70	1317.66	61	NVTVEEINAAMK	37A_4
281	667.94	1333.86	1333.65	57	NVTVEEINAAMK +Oxidation (M)	37_4
109	556.44	1110.87	1110.61	55	TLGYFAQLAK	37A_4
177	589.88	1177.75	1177.63	64	VLNDKYGIEK	37_4
579	887.35	1772.68	1771.98	98	VPVVTGSITELVCTLGK	biorepCdiff_2
174	585.90	1169.79	1169.67	58	VVISAPATGDLK	37_4
635	1046.29	2090.56	2089.98	65	VVSWYDNEMSYTSQLIR	biorepCdiff_2
445	1054.23	2106.44	2105.97	50	VVSWYDNEMSYTSQLIR +Oxidation (M)	37A_4

Matching Genes:

gi|115252231|emb|CAJ70071.1| (glyceraldehyde-3-phosphate dehydrogenase 2 [Clostridium difficile 630])

Protein Group 5

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
1321	71	26	16	35

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
130	681.60	1361.19	1360.69	34	AVTDLLDEMNIK	biorepCdiffA_7
106	641.46	1280.92	1280.55	40	DMYLNSYYGR	biorepCdiffA_7
168	462.26	922.50	923.42	36	EFGVEESK	37_2
45	497.84	993.67	994.47	34	ENMLWFR	biorepCdiffA_7
133	533.83	1065.65	1065.46	47	ETGMGIAEDK +Oxidation (M)	37_7
209	744.49	1486.96	1486.77	39	EVDLTLATGGPGMVK	37A_7
54	433.24	864.47	864.40	49	FNSSDAPK	37_7
137	688.54	1375.06	1374.78	48	FQSLLVAIEDLK	biorepCdiffA_7
452	1011.19	2020.37	2019.92	57	HTTFFEVEPDPTLECAK	37_7
568	1205.91	2409.81	2409.35	30	IAEPIGVIAAVVPTTNPTSTAIFK	37_7
284	714.98	1427.94	1427.69	58	IFATYSQEQVDK	37_7
119	560.02	1118.02	1117.65	58	IFLAASLAANK	biorepCdiff_7
359	1019.31	2036.60	2036.06	85	ILINTPSSQGGIGDLYNFK	37A_7
100	581.50	1160.98	1160.62	78	IVGQTACTIAK	37A_7
84	588.52	1175.02	1174.62	36	LAGFEVPVDTK	biorepCdiffA_7
99	511.54	1021.07	1020.57	30	LSPVLAMYK	biorepCdiff_7
549	1161.83	2321.65	2321.09	91	LVEDGGFGHTSSLYIDDVNQR	37_7
351	818.57	1635.13	1634.74	59	NHYASEYIYNAYK	37_7
158	621.64	1241.27	1240.71	49	NIILVNGGLNSK	biorepCdiff_7
124	516.36	1030.70	1030.60	71	TAVNSILVSK	37_7
235	562.91	1685.72	1684.78	27	TCGVIEKDEAFGMTK	biorepCdiffA_7
271	567.98	1700.93	1700.77	39	TCGVIEKDEAFGMTK +Oxidation (M)	37A_7
423	710.19	2127.54	2127.07	77	VLIGEVESVEIEEAFAHEK	37A_2
101	485.84	969.66	969.57	51	VPLAIMAQK	37_7
110	493.85	985.68	985.56	29	VPLAIMAQK +Oxidation (M)	37_7
151	570.43	1138.85	1138.64	69	YAGIASFLGLK	37_7

Matching Genes:

gi|115252023|emb|CAJ69859.1| (aldehyde-alcohol dehydrogenase [includes: alcohol dehydrogenase and pyruvate-formate-lyase deactivase [Clostridium difficile 630])

Protein Group 6

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
1180	59	21	17	48

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
341	643.50	1927.48	1927.01	53	DKYPGLIFSQILGYGEK	37_5
51	462.81	923.61	923.51	47	EGVEILHK	37A_5
202	697.95	1393.89	1393.65	44	ENPNSPLMTTYK	37_5
275	706.04	1410.07	1409.65	37	ENPNSPLMTTYK +Oxidation (M)	biorepCdiff_5
83	511.31	1020.61	1020.49	66	GGVSQSVMEK	37_5
92	549.86	1097.71	1097.57	29	IEPIEGDGIR	37_5
519	1279.29	2556.57	2556.15	74	IQSCEDLLDDEQAWANDFLFK	37_5
69	495.31	988.61	988.53	60	IVGEAMLEK	37A_5
297	739.10	1476.18	1475.80	43	LLSEADIFVTNVR	37_6
97	519.94	1037.86	1037.52	34	MGIAYDQIK	biorepCdiff_5
108	609.91	1217.80	1217.61	50	MLGDWGAEVIK	37_5
112	617.93	1233.85	1233.61	50	MLGDWGAEVIK +Oxidation (M)	37A_5
97	570.36	1138.71	1138.63	36	SKEGVEILHK	37_5
250	779.01	1556.01	1555.75	58	SLGYDEEKINNFK	37_5
348	997.65	1993.28	1992.84	77	SPASDDENPMFELENGNK	37A_5
354	1005.61	2009.20	2008.83	70	SPASDDENPMFELENGNK +Oxidation (M)	37A_5
387	1061.70	2121.39	2120.93	91	SPASDDENPMFELENGNKK	37A_5
399	1069.71	2137.40	2136.93	66	SPASDDENPMFELENGNKK +Oxidation (M)	37A_5
382	1053.73	2105.45	2105.02	73	TLDEWSALLEEADLPFEK	37A_6
85	555.37	1108.72	1108.62	66	VGQHTVEVLK	37A_5
182	695.47	1388.92	1388.78	56	WIQLALIQYNK	37A_5

Matching Genes:

gi|115249401|emb|CAJ67216.1| (isocaprenoyl-CoA:2-hydroxyisocaproate CoA-transferase [Clostridium difficile 630])

Protein Group 7

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
1107	55	22	17	49

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
119	528.34	1054.66	1054.51	32	AFDITFADR	37_6
376	864.89	1727.76	1727.89	44	ALCEELLAMPVVAGQK	biorepCdiff_6
382	880.13	1758.25	1757.88	65	ALQSGTSHFLGQHFTK	37_6
139	669.02	1336.03	1335.62	51	DIENNQAMVFR	biorepCdiffA_6
245	676.93	1351.85	1351.62	61	DIENNQAMVFR +Oxidation (M)	37_6
90	556.35	1110.68	1111.49	47	EADSMVVMAK +2 Oxidation (M)	37A_7
128	548.83	1095.64	1095.49	46	EADSMVVMAK +Oxidation (M)	37_6
442	755.51	2263.49	2263.07	64	EAEHVEGFAPEVAWVTHGGNK	37A_6
403	914.16	1826.30	1825.82	42	EDNTSIVENMDEFRK	37_6
410	922.14	1842.26	1841.81	34	EDNTSIVENMDEFRK +Oxidation (M)	37_6
419	931.13	1860.25	1859.86	76	EGNLANPYHTSWGASTR	37_6
448	963.18	1924.34	1923.90	53	GVAVEVDDRDNYTTGWK	biorepCdiff_6
83	559.38	1116.75	1116.61	39	IKEETGATIR	37A_6
85	560.82	1119.62	1119.56	80	KGNVMETVDK	37A_6
485	1022.34	2042.67	2042.00	26	LCVRPTSETIICTMYAK	biorepCdiff_6
330	944.57	1887.14	1886.84	45	MEDDFPQWYTDVITK	37A_6
335	952.63	1903.24	1902.83	79	MEDDFPQWYTDVITK +Oxidation (M)	37A_6
95	497.35	992.69	992.52	40	QFVEEITK	biorepCdiff_6
84	560.80	1119.58	1119.58	59	TDLVDYAPVK	37A_6
292	737.38	1472.74	1472.54	38	TMWCGDAECEAK +Oxidation (M)	37_6
203	714.83	1427.64	1427.61	43	TYTIEAMMHDGK +2 Oxidation (M)	37A_6
199	709.57	1417.13	1416.91	43	VAPIQVVIVPIAAK	37A_6

Matching Genes:

gi|115249053|emb|CAJ66864.1| (putative dual-specificity prolyl/cysteinyl-tRNA synthetase [Clostridium difficile 630])

Protein Group 8

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
1027	43	18	15	39

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
455	814.23	2439.68	2439.29	59	DSPLVVGVGEGENFIASDIPALLK	37A_7
156	583.37	1164.72	1164.59	35	EIHEQPTGVR	37_7
382	1086.85	2171.68	2171.01	67	ESDDVFYTWAGPEVAVASTK	37A_7
417	611.49	1831.46	1830.90	49	FESQTDTEVIAHLVDK	biorepCdiff_6
370	861.17	1720.32	1719.92	75	FVNIPVITDIASEFR	37_6
247	679.45	1356.89	1356.71	67	GAYVVAIAQSHNK	37_6
258	700.48	1398.95	1398.67	73	GIDYSLAMEGSLK +Oxidation (M)	37_6
105	614.52	1227.03	1226.69	45	GTPVIAIATQEK	biorepCdiffA_6
304	749.48	1496.96	1496.67	105	GYDSAGVAVNSSNEK	37_6
64	491.34	980.67	980.57	56	HGTIALIEK	37A_6
286	715.56	1429.10	1428.83	65	ILSITNVVGSSIAR	37_7
228	753.87	1505.73	1505.76	50	IQEILDNEEYIK	37A_6
112	622.47	1242.93	1242.72	81	KAAEVIVEGLSK	biorepCdiffA_6
149	563.84	1125.66	1125.48	43	MVSNMEEVR +2 Oxidation (M)	37_7
80	555.39	1108.76	1109.48	26	MVSNMEEVR +Oxidation (M)	37A_6
279	733.56	1465.10	1464.74	48	TVVSSEHAFYLGR	biorepCdiff_6
287	885.72	1769.43	1768.92	36	VYIVACGTAYNAGLLGK	37A_7
580	754.05	2259.14	2258.03	47	WATHGEPSDVNSHPHFNQAK	biorepCdiff_6

Matching Genes:

gi|115249129|emb|CAJ66940.1| (glucosamine--fructose-6-phosphate aminotransferase [isomerizing] [Clostridium difficile 630])

Protein Group 9

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
1019	35	21	12	34

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
271	484.38	1450.13	1449.69	37	AGAPFAPGANPMHGR	biorepCdiff_7
416	757.16	2268.47	2268.04	36	AGIVTEEELQEYMDHFVMK	37A_7
58	476.27	950.53	950.49	34	AVMPYGGIK +Oxidation (M)	37A_7
150	568.32	1134.62	1134.51	34	DQNGAAMSLGR +Oxidation (M)	37_7
494	936.61	2806.80	2807.29	64	EFIQLNYSPYEGNDSFLAGATENTK	37A_7
199	717.40	1432.79	1432.68	58	ERENGGTLDVDTK	37A_7
363	1033.19	2064.36	2064.92	68	FEPITSEYLDYDEVMSK	37A_7
467	1041.71	2081.40	2080.92	46	FEPITSEYLDYDEVMSK +Oxidation (M)	37_7
141	460.73	1379.17	1378.73	53	KLWDEAMVLFK	biorepCdiffA_7
451	1214.83	2427.65	2427.24	28	LPYEHAQDGISNTFSIVPAALGK	37A_7
102	626.61	1251.20	1250.64	31	LWDEAMVLFK	biorepCdiffA_7
388	923.61	1845.20	1844.86	90	MAESYGFDISKPATNSK	37_7
401	621.44	1861.30	1860.86	47	MAESYGFDISKPATNSK +Oxidation (M)	37_7
43	491.35	980.69	980.45	31	MNAWQGFK	biorepCdiffA_7
368	1066.36	2130.71	2129.93	34	MVENSCEAFGYELDPEIK	biorepCdiffA_7
469	1043.36	2084.71	2084.08	50	NSYPTQSILTITSNVVYGK	37_7
132	660.47	1318.93	1318.69	53	SGIITGLPDAYGR	biorepCdiffA_6
67	549.47	1096.92	1096.59	33	VSGYAVNFIK	biorepCdiffA_7
437	986.69	1971.36	1970.89	104	VSIDTSSVQYENDDLMR	37_7
443	994.66	1987.30	1986.88	48	VSIDTSSVQYENDDLMR +Oxidation (M)	37_7
209	533.48	1597.43	1596.72	40	YSYEALEMALHDR	biorepCdiffA_7

Matching Genes:

gi|115249776|emb|CAJ67593.1| (formate acetyltransferase [Clostridium difficile 630])

Protein Group 10

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
997	52	17	14	41

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
592	1058.89	3173.66	3173.59	99	ALEAANMTIEDIDLVEANEAFAAQSVAVIR	37A_5
633	1064.39	3190.14	3189.59	55	ALEAANMTIEDIDLVEANEAFAAQSVAVIR +Oxidation (M)	37_5
537	1370.81	2739.60	2738.43	86	ANITPDMIDESLLGGVLTAGLGQNIAR	37A_5
539	1378.53	2755.05	2754.42	79	ANITPDMIDESLLGGVLTAGLGQNIAR +Oxidation (M)	37A_5
325	936.68	1871.34	1871.00	63	AQAEGKFDEEIVPVVIK	37_5
432	1132.33	2262.64	2262.10	82	DGTVTAGNASGINDGAAMLVVMAK	37A_5
439	1148.11	2294.20	2294.09	71	DGTVTAGNASGINDGAAMLVVMAK +2 Oxidation (M)	37A_5
461	1140.31	2278.61	2278.09	56	DGTVTAGNASGINDGAAMLVVMAK +Oxidation (M)	37_5
72	481.82	961.63	961.45	35	DLNIDMNK	37_5
226	738.02	1474.04	1473.69	69	EEQDELALASQNK	37_5
141	644.50	1286.98	1286.71	47	FDEEIVPVVIK	biorepCdiffA_5
113	613.01	1224.00	1223.68	43	ILTTLLYEMK	37_5
120	620.90	1239.78	1239.68	38	ILTTLLYEMK +Oxidation (M)	37A_5
121	567.42	1132.83	1132.60	39	IMGYGPVPATK	biorepCdiff_5
96	575.39	1148.76	1148.59	45	IMGYGPVPATK +Oxidation (M)	37A_5
218	616.37	1230.73	1230.68	45	SVSAVELGVTAAK	37A_1
66	521.46	1040.90	1040.53	45	TAVGSFGGAFK	biorepCdiffA_5

Matching Genes:

gi|115250080|emb|CAJ67900.1| (acetyl-CoA acetyltransferase [Clostridium difficile 630])

Protein Group 11

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
980	55	16	15	41

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
59	530.02	1058.02	1057.60	50	AVTVAVEELK	biorepCdiffA_6
94	496.36	990.71	990.48	67	EADLSMLGR	biorepCdiff_6
489	883.93	2648.76	2648.36	57	EMLQDIAILTGAQVISEELGYDLK	biorepCdiffA_1
176	668.91	1335.82	1335.65	44	ESTTIVDGSGDKK	37A_6
269	767.05	1532.09	1531.82	73	FGSPLITNDGVTIAK	biorepCdiffA_2
77	468.40	934.78	934.51	57	GTFDVVAVK	biorepCdiff_6
502	717.45	2149.34	2148.22	86	ISNIQELLPVLEQIVQQGK	37_6
59	478.30	954.59	954.55	42	KALEEPLR	37A_6
588	760.02	2277.03	2276.31	33	KISNIQELLPVLEQIVQQGK	biorepCdiff_6
2	407.31	812.60	812.51	41	LAGGVAVVK	37A_6
150	587.48	1172.94	1172.65	59	LIAEAMEIVGK	37_6
613	709.15	2124.43	2125.19	72	LLIIAEDVEGEALSTLVVNK	37_2
126	619.89	1237.76	1237.71	64	NVTAGANPILLR	37A_6
520	1105.38	3313.11	3312.68	51	QIAINAGLEGAVIVQNVVNSEAETGFDALNEK	biorepCdiffA_2
373	1044.81	2087.60	2087.09	108	TNDVAGDGTTTATVLAQAIIR	37A_6
113	508.83	1015.64	1015.55	76	VGAATEVELK	37_6

Matching Genes:

gi|115249204|emb|CAJ67016.1| (60 kDa chaperonin [Clostridium difficile 630])

Protein Group 12

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
943	43	15	15	59

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
219	665.01	1328.01	1327.73	67	ALENVLKDDLAK	37A_4
526	1056.83	2111.65	2111.09	56	ALEVGIDPILCVGETLEQR	37_4
126	596.34	1190.67	1190.62	50	EALEFVNEIK	37A_4
331	717.99	1433.97	1433.74	64	EALEFVNEIKDK	37_4
319	832.46	1662.91	1661.77	49	EIDMDYVVIGHSER	37A_4
326	840.10	1678.18	1677.77	64	EIDMDYVVIGHSER +Oxidation (M)	37A_4
138	610.84	1219.67	1219.62	64	GLYGELANEVR	37A_4
260	652.39	1302.77	1302.60	67	IGAQNMHFEEK	37_4
271	660.41	1318.80	1318.60	53	IGAQNMHFEEK +Oxidation (M)	37_4
135	513.85	1025.68	1025.60	45	KPIIAGNWK	37_4
342	744.46	1486.90	1486.66	58	QYFNETDETVNK	37_4
301	808.49	1614.96	1614.75	76	QYFNETDETVNKK	37A_4
390	820.05	1638.08	1637.79	91	TATAEDANDVISYIR	37_4
425	1002.67	2003.33	2003.08	57	VNSDKVEAVICAPFTLLK	37A_4
514	802.07	1602.12	1601.88	82	VVVAYEPIWAIGTGK	37_3

Matching Genes:

gi|115252229|emb|CAJ70069.1| (triosephosphate isomerase [Clostridium difficile 630])

Protein Group 13

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
918	48	14	13	43

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
468	683.12	2046.33	2046.08	70	AAADEIGLPLFQYLGGVNAK	37_6
641	1237.05	2472.08	2471.17	28	AGYKPGEDVMLGLDVAATEMYNK	biorepCdiff_6
75	537.85	1073.68	1073.56	69	AGYTAVISHR	37A_6
287	888.15	1774.29	1773.93	101	AIVPSGASTGAFEAVELR	37A_6
169	664.89	1327.77	1327.76	71	EALELIVEAITK	37A_6
159	657.48	1312.96	1312.73	83	GIENGVANSILVK	37A_6
145	581.35	1160.69	1160.55	57	IEEMVGEQAR	37_6
99	589.34	1176.66	1176.54	56	IEEMVGEQAR +Oxidation (M)	37A_6
60	482.32	962.62	963.54	49	KYVLAGEGK	37A_6
285	730.06	1458.11	1457.80	45	LGANAILGVSMAVAR +Oxidation (M)	37_6
274	860.72	1719.42	1718.88	83	LQLVGDDLFVTNTER	37A_7
84	560.03	1118.04	1117.56	65	MGAEVFHSLK	biorepCdiffA_5
516	1095.30	2188.58	2188.09	93	SGETEDSTIADLAVAVNAGQIK	37_6
57	525.50	1048.98	1048.59	48	SVIELVYAR	biorepCdiffA_6

Matching Genes:

gi|115252227|emb|CAJ70067.1| (enolase [Clostridium difficile 630])

Protein Group 14

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
907	36	16	14	32

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
614	1342.45	2682.88	2682.27	103	AEVTDVANAIYDGTDAIMLSGETAAGK	37_7
98	574.32	1146.63	1146.55	56	DGEVVTVDASR	37A_7
573	806.17	2415.49	2415.20	50	DISDIEFGISQGIDYIAASFVR	37_7
396	928.25	1854.48	1853.94	41	GDLGVEIPTEEMPIVQK	37_7
278	872.08	1742.14	1741.87	85	IENQEGVENLDEILK	37A_7
38	483.92	965.82	965.59	47	INLPAITPK	biorepCdiffA_7
65	486.88	971.74	971.58	46	KASDVLAIR	37A_7
219	649.39	1296.77	1296.59	31	RTEETLDYDR	37_7
222	765.51	1529.00	1528.81	54	SGDSILIDDGLVGLR	37A_7
160	594.39	1186.76	1186.62	68	SPIIATTNNEK	37_7
225	674.97	1347.92	1347.65	98	SSVAGNTDEVIEK	biorepCdiff_6
152	571.34	1140.66	1140.49	41	TEETLDYDR	37_7
298	920.09	1838.17	1837.84	76	TGNFEDPEVFLEEGQK	37A_7
57	474.36	946.71	946.49	40	VSDGIMVAR	37A_7
62	482.28	962.54	962.49	30	VSDGIMVAR +Oxidation (M)	37A_7
5	403.29	804.56	804.44	41	YPVEAVK	37_7

Matching Genes:

gi|115252454|emb|CAJ70297.1| (pyruvate kinase [Clostridium difficile 630])

Protein Group 15

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
877	61	17	12	51

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
613	1270.90	2539.79	2539.30	78	AYEGGFAIGAFNISDLEQLQGVLK	37_4
143	530.38	1058.74	1058.56	66	DAIQAVVESK	37_4
140	611.47	1220.93	1220.63	60	FDILEEIQSK	37A_4
8	409.73	817.46	817.43	34	FLAENPK	37A_4
87	609.58	1217.14	1216.59	31	IDDVLGSANSIN	biorepCdiffA_4
115	489.27	976.53	976.46	59	INMDTDLR	37_4
83	497.23	992.44	992.46	53	INMDTDLR +Oxidation (M)	37A_4
72	473.78	945.54	945.53	49	KFLAENPK	37A_4
29	423.97	845.93	845.48	32	LAMTAAIR	biorepCdiff_4
40	431.80	861.58	861.47	34	LAMTAAIR +Oxidation (M)	37A_4
289	780.94	1559.87	1559.73	56	NSYVMIQASMSAVK +2 Oxidation (M)	37A_4
285	772.91	1543.81	1543.74	55	NSYVMIQASMSAVK +Oxidation (M)	37A_4
654	911.80	2732.39	2732.18	30	TCIDAGFSSVMIDGSHFDFEENVR	biorepCdiff_4
346	873.09	1744.17	1743.92	63	TGVDSLAIAIGTSHGAFK	37A_4
283	448.97	1343.90	1343.69	58	YAGPHTLVEMVK	37_4
231	680.98	1359.94	1359.69	57	YAGPHTLVEMVK +Oxidation (M)	37A_4
481	770.11	1538.20	1537.74	62	YTQPAEAVEFVER	biorepCdiff_3

Matching Genes:

gi|115249409|emb|CAJ67224.1| (putative fructose-bisphosphate aldolase [Clostridium difficile 630])

Protein Group 16

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
826	20	15	12	28

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
229	757.47	1512.92	1512.83	30	AVLEGMDGKPIVIR +Oxidation (M)	37A_6
106	513.89	1025.77	1025.59	41	GIGASPGVALGK	biorepCdiff_6
67	500.73	999.44	1000.56	38	GKPSVTLDGK	37A_6
310	925.74	1849.46	1848.97	37	IMFPMISSLEELLQAK	37A_6
364	849.65	1697.29	1696.89	62	ISYLYNQFNPAVLR	37_6
51	466.31	930.61	930.50	51	LEDAVAVSK	37A_6
232	765.52	1529.03	1528.83	50	LEDAVAVSKEELVK	37A_6
494	884.02	2649.03	2648.36	53	MIPILLGMGLDEFSMSPISILPAR +3 Oxidation (M)	37A_6
612	873.21	2616.61	2616.37	80	MIPILLGMGLDEFSMSPISILPAR +Oxidation (M)	37_6
199	639.97	1277.92	1277.68	77	MVLGFLTDIGGR	37_6
213	647.95	1293.88	1293.68	64	MVLGFLTDIGGR +Oxidation (M)	37_6
126	547.32	1092.63	1092.52	58	NDAEGVGLYR	37_6
92	594.93	1187.84	1187.60	51	SIDNVEAEIAK	biorepCdiffA_6
328	791.03	1580.05	1579.77	71	TESVNAEYALNEIK	37_6
191	698.86	1395.70	1395.55	63	WAGMCGESAGDQK	37A_6

Matching Genes:

gi|115251808|emb|CAJ69643.1| (phosphoenolpyruvate-protein phosphotransferase [Clostridium difficile 630])

Protein Group 17

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
820	90	12	12	64

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
114	452.34	902.67	902.53	56	AFLGLLNR	37A_1
222	628.33	1254.64	1254.58	73	EGYPEVAEAYK	37A_2
428	706.42	1410.83	1410.68	41	EGYPEVAEAYKR	37_3
302	746.03	1490.04	1489.80	101	FAELLGEVVVADTK	37A_3
480	880.60	2638.76	2638.14	40	FVCTVCGYIHEGDAAPAQCPVCK	37A_2
286	615.32	1228.64	1228.53	46	GEMVWADEHR	37_2
267	608.44	1214.86	1214.59	63	IAFEEAEHAAK	biorepCdiff_2
541	820.57	1639.12	1638.89	121	IGVAQGVDAEIIEGLR	37_2
250	563.30	1124.58	1124.50	70	VDAEYGATDGK	37_2
247	577.34	1152.67	1152.55	58	VGADKFEEMK	37_3
254	585.32	1168.63	1168.54	58	VGADKFEEMK +Oxidation (M)	37_3
264	690.95	1379.88	1379.67	93	VRVDAEYGATDGK	37A_3

Matching Genes:

gi|115250565|emb|CAJ68389.1| (putative rubrerythrin [Clostridium difficile 630])

Protein Group 18

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
808	35	13	12	38

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
522	1286.41	2570.81	2570.27	137	DILDILEDNNISVVADDLAQETR	37_5
272	856.53	1711.05	1710.77	57	ELEEICGYEIEEAK	37_5
100	585.38	1168.74	1168.61	55	EVVENPNAAVK	37_5
259	851.96	1701.91	1701.73	51	FCDPEEYDYPLVR	37A_5
99	576.89	1151.76	1151.64	53	HSNTIKPSIR	37_5
243	509.29	1524.85	1524.73	59	IHESIEVYNEHR	37_5
167	675.88	1349.75	1349.60	38	LNAMPEEVCSGK +Oxidation (M)	37A_5
210	714.98	1427.94	1427.74	55	MKEVVENPNAAVK	37_5
192	722.97	1443.93	1443.74	74	MKEVVENPNAAVK +Oxidation (M)	37A_5
274	884.48	1766.94	1766.79	60	QWSNIEGCSLAYDPK	37A_5
126	629.83	1257.65	1257.58	49	TDVPAGDDALER	37A_5
92	565.44	1128.86	1128.68	69	VLLTGILADSK	37A_5
108	613.92	1225.82	1225.66	51	YISLVHPQNR	37A_5

Matching Genes:

gi|115249404|emb|CAJ67219.1| (subunit of oxygen-sensitive 2-hydroxyisocaproyl-CoA dehydratase [Clostridium difficile 630])

Protein Group 19

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
769	36	14	10	43

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
87	556.88	1111.74	1111.57	35	ALSIWMTFK +Oxidation (M)	37A_5
337	748.28	1494.54	1493.72	30	DVNVFEMAQSQVK	biorepCdiff_5
88	533.30	1064.58	1064.50	49	EAAYMHSIK +Oxidation (M)	37_5
385	886.16	1770.30	1769.92	68	GGIIVDPSTLSQGELER	37_6
53	464.82	927.62	927.47	34	GYIDGIYK	37A_5
464	1011.78	2021.54	2021.03	89	IAVQGIGNVGSYTVLNCEK	37_6
215	649.43	1296.85	1297.63	43	IKEEYNVTMR +Oxidation (M)	37_6
175	681.99	1361.97	1361.73	46	LGMEPAVYELLK	37A_5
452	1130.83	2259.65	2259.22	57	LTGQSSIGVITGKPVEFGGSLGR	37_5
458	1138.77	2275.53	2275.04	68	LVCEAANGPTTPEADEVFAER	37_5
496	1285.21	2568.41	2568.11	89	SEGSYAIYNENGLDGQAMLDYMK	37A_5
502	1293.63	2585.24	2584.11	32	SEGSYAIYNENGLDGQAMLDYMK +Oxidation (M)	37A_5
117	611.40	1220.79	1220.65	73	TAATGFGVAVTAR	37A_6
103	492.36	982.70	982.61	56	VIEVSIPVK	37_6

Matching Genes:

gi|115249189|emb|CAJ67001.1| (NAD-specific glutamate dehydrogenase [Clostridium difficile 630])

Protein Group 20

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
750	54	15	9	48

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
489	743.02	2226.04	2225.15	28	DAIDEIKPEIMLFGATHIGR	biorepCdiffA_5
78	497.30	992.59	992.52	47	ELITFGADK	37_5
211	715.44	1428.86	1429.75	29	EVDAELCAILLGK	37_5
300	683.55	1365.08	1364.80	80	IAPVVIELLGEGR	37_4
37	430.80	859.58	859.44	44	ITQDDIR	37A_4
174	665.92	1329.82	1329.70	41	LDSVDDLLEAIK	37_5
320	701.48	1400.95	1400.74	85	LDSVDDLLEAIKA	37_4
98	543.88	1085.74	1085.56	37	LEIDPEDKK	37A_4
14	416.30	830.59	830.46	47	LGGVVGSSR	37_5
580	1006.38	3016.13	3015.60	60	NPAAPILEIADYGVVGDLHEIVPMLIEK	37A_4
133	581.96	1161.90	1161.59	27	NVWIFAEQR	biorepCdiff_5
108	554.88	1107.75	1107.58	93	TGEVIALDYK	37A_4
53	445.83	889.65	889.51	35	TTVLETVK	37A_4
95	561.92	1121.82	1121.54	69	VGTGLTADCTK	37_5
112	481.79	961.57	961.44	28	YTTDAYTK	37_4

Matching Genes:

gi|115249407|emb|CAJ67222.1| (electron transfer flavoprotein alpha-subunit [Clostridium difficile 630])

Other Genes Matching Peptide Subset:

gi|115249822|emb|CAJ67639.1| (electron transfer flavoprotein alpha-subunit [Clostridium difficile 630])

Protein Group 21

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
697	83	10	10	58

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
114	452.34	902.67	902.53	56	AFLGLLNR	37A_1
196	621.37	1240.72	1240.56	53	EGYPEVGEAYK	37A_3
302	746.03	1490.04	1489.80	101	FAELLGEVVVADTK	37A_3
480	880.60	2638.76	2638.14	40	FVCTVCGYIHEGDAAPAQCPVCK	37A_2
183	591.37	1180.73	1180.61	66	IALEEAEHAAK	37A_2
385	849.69	1697.36	1696.90	102	IGVAQGVDEEIIEGLR	37A_1
250	563.30	1124.58	1124.50	70	VDAEYGATDGK	37_2
247	577.34	1152.67	1152.55	58	VGADKFEEMK	37_3
254	585.32	1168.63	1168.54	58	VGADKFEEMK +Oxidation (M)	37_3
264	690.95	1379.88	1379.67	93	VRVDAEYGATDGK	37A_3

Matching Genes:

gi|115250515|emb|CAJ68339.1| (putative ruberythrin [Clostridium difficile 630])

Protein Group 22

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
666	36	11	8	28

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
207	652.59	1303.16	1302.71	36	ALQLHGGYGFIK	biorepCdiff_5
198	631.40	1260.79	1260.59	51	ELDTLPAEMDK	37_7
143	639.42	1276.83	1276.59	25	ELDTLPAEMDK +Oxidation (M)	37_5
55	523.93	1045.84	1045.56	71	IAMGTLEVGR	biorepCdiffA_7
76	531.80	1061.58	1061.55	70	IAMGTLEVGR +Oxidation (M)	37A_5
322	627.38	1879.13	1879.08	100	IGVAALALGIAQGALDEAVK	37A_5
292	727.02	1452.02	1451.75	94	IVSIYEGTSEVQK	37_7
89	495.93	989.84	989.56	34	MVISSNVLK	biorepCdiff_5
68	494.37	986.72	986.59	50	VQFGKPIAK	37A_5
249	675.40	1348.78	1348.57	56	WDGFSTGAHEDK	37_7
318	761.02	1520.02	1519.72	79	YYASEIANEVAYK	37_7

Matching Genes:

gi|115249405|emb|CAJ67220.1| (acyl-CoA dehydrogenase, short-chain specific [Clostridium difficile 630])

Protein Group 23

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
660	37	12	9	42

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
448	905.14	1808.27	1807.91	93	AFAGADTWATSSALAGALK	37_4
31	415.80	829.59	829.45	61	AGLEEAIK	37_4
95	536.37	1070.73	1070.63	28	AGLEEAIKLK	37A_4
515	1041.29	2080.56	2080.07	61	DGVPSIINPDDKAGLEEAIK	37_4
199	650.34	1298.66	1298.67	56	DIEVDPSNLGLK	37A_4
108	475.27	948.52	948.43	26	EALAMGADR +Oxidation (M)	37_4
155	550.38	1098.75	1098.60	57	LDPNTGTLIR	37_4
96	538.84	1075.66	1075.58	50	MPCLITTLK	37A_4
101	546.89	1091.77	1091.57	58	MPCLITTLK +Oxidation (M)	37A_4
87	508.76	1015.50	1015.52	39	QVPDTTEVK	37A_4
276	747.04	1492.06	1491.76	78	SVKPAGTIYNEDAK	37A_4
90	459.31	916.61	916.52	53	TSAGIIIDK	37_4

Matching Genes:

gi|115250076|emb|CAJ67896.1| (electron transfer flavoprotein beta-subunit [Clostridium difficile 630])

Protein Group 24

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
645	15	9	8	22

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
415	1110.31	2218.60	2218.17	65	AFVVGGTGLADAMSIAPVASQLK +Oxidation (M)	37A_5
392	1049.77	2097.53	2097.07	85	DGSTKEDQLVDALAAAPIAGR	37_5
480	1178.90	2355.79	2355.22	64	ESPAPIILATDTLSSDQNVAVSK	37_5
273	743.92	1485.83	1485.80	70	IITNQADAEAIVTK	37A_4
380	1031.67	2061.33	2061.92	36	LGDGDYVDFSVDYNLENK	37_5
163	660.94	1319.86	1319.71	62	LYNLVNTQLDK	37A_6
199	737.91	1473.81	1473.63	79	SGGSEDTGYVVEMK +Oxidation (M)	37A_5
330	940.17	1878.32	1877.97	106	VDVTGGSTPSAVAVSGFVTK	37_5
221	773.88	1545.74	1545.69	78	YYNSDDKNAITDK	37A_5

Matching Genes:

gi|115251846|emb|CAJ69681.1| (cell surface protein (S-layer precursor protein) [Clostridium difficile 630])

Protein Group 25

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
623	31	10	7	52

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
420	711.07	1420.12	1419.67	80	EIMDAANNTGASVK	biorepCdiff_3
311	718.92	1435.82	1435.66	71	EIMDAANNTGASVK +Oxidation (M)	37A_2
266	669.99	1337.97	1337.72	87	IVYDAFAIVAEK	37A_2
249	558.82	1115.62	1115.60	68	LINNLMVDGK	37_2
169	566.86	1131.70	1131.60	38	LINNLMVDGK +Oxidation (M)	37A_2
430	696.54	1391.07	1390.69	54	REVLPDPMYGSK	biorepCdiff_2
57	422.28	842.55	842.51	36	RQTLGLR	37_2
378	647.48	1939.43	1939.04	35	RVGGANYQVPIEVRPER	biorepCdiffA_2
209	618.89	1235.77	1235.60	95	TGEEALEVFNK	37A_2
566	595.38	1783.11	1782.94	59	VGGANYQVPIEVRPER	37_2

Matching Genes:

gi|115249073|emb|CAJ66884.1| (30S ribosomal protein S7 [Clostridium difficile 630])

Protein Group 26

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
616	31	11	6	29

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
202	641.44	1280.86	1280.66	70	ESTIEFLTSVR	37_6
101	592.39	1182.76	1182.63	78	GISDFLLSFGK	37A_6
301	759.13	1516.24	1515.83	30	GNVLEGLKPESVFK	biorepCdiff_6
561	1151.77	2301.53	2301.01	96	HEFTTSDPGMTYSVAETSVDK	37_6
562	1159.76	2317.50	2317.01	86	HEFTTSDPGMTYSVAETSVDK +Oxidation (M)	37_6
72	515.28	1028.54	1028.45	35	ICSETYEK	37A_6
614	874.75	2621.22	2622.38	42	LLAQALGANYDLIAQYPAWEFKK	37_6
211	485.61	1453.82	1453.76	32	NVEHDFLKDPIK	37A_6
302	748.02	1494.02	1493.71	29	SSVMSIRDEIADR +Oxidation (M)	37_6
191	648.02	1294.02	1293.66	35	TCVVSLPVEYK	biorepCdiff_6
350	990.26	1978.50	1978.03	83	VLSVLNVDYELASVDGGTK	37A_6

Matching Genes:

gi|115249724|emb|CAJ67541.1| (putative aminoacyl-histidine dipeptidase [Clostridium difficile 630])

Protein Group 27

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
611	20	12	7	25

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
108	646.96	1291.91	1291.61	35	ELISNGCDAVSK	biorepCdiffA_7
149	657.48	1312.94	1312.80	30	EVIPEFLLLLK	37A_7
253	825.46	1648.91	1648.67	71	FAGMDLGMNFEEEK +2 Oxidation (M)	37A_7
276	862.56	1723.11	1722.85	25	FIDNGIGMTEEEIKK	37A_7
161	594.92	1187.83	1187.64	66	LVSLGEISENK	37_7
302	769.63	1537.25	1536.79	33	LYNNQVFVADNIK	biorepCdiff_7
377	895.16	1788.31	1787.87	61	NEDTPAMVLVSEQSIR	37_7
122	671.00	1339.98	1339.77	40	TLVINENSPIIK	biorepCdiffA_7
402	931.66	1861.31	1860.93	32	VFYVSDKEQQSQYIK	37_7
254	826.59	1651.17	1650.90	48	VIEPLNDTNPLWLK	37A_7
333	965.10	1928.19	1927.84	79	WISEGGTEYEISESDAR	37A_7
301	925.61	1849.20	1848.87	91	YINQVAFSGAEDFFNK	37A_7

Matching Genes:

gi|115249282|emb|CAJ67095.1| (chaperone protein (heat shock protein) [Clostridium difficile 630])

Protein Group 28

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
590	50	8	8	43

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
495	970.46	1938.91	1937.95	82	AFGGADTWATSNTIAAGISK	biorepCdiff_4
630	694.50	2080.47	2080.03	65	DGVPSILNPDDANALEEALK	37_3
355	883.45	1764.89	1764.80	105	ECLAMGADDAILLSDR +Oxidation (M)	37A_4
420	871.10	1740.18	1739.87	111	QAIDGDTAQVGPQIAEK	37_4
168	604.41	1206.81	1206.61	70	QLEDGYELIK	37A_3
142	529.33	1056.65	1056.52	44	QVPDTNEVR	37_4
180	613.33	1224.64	1224.61	67	VGDYDIIFAGR	37A_3
142	564.35	1126.69	1126.70	46	VSTPVLLTAVK	37A_3

Matching Genes:

gi|115249406|emb|CAJ67221.1| (electron transfer flavoprotein beta-subunit [Clostridium difficile 630])

Protein Group 29

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
537	39	11	8	47

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
33	416.78	831.55	831.45	48	CLALLDK	37_4
512	692.17	2073.47	2073.12	68	ILIPMINEAVGIYADGVASK	37_4
657	922.74	2765.19	2764.33	26	LAVIGSGTMGSGIVQTFASCGHDVCLK	biorepCdiff_4
557	928.09	2781.26	2780.33	42	LAVIGSGTMGSGIVQTFASCGHDVCLK +Oxidation (M)	37A_4
29	445.75	889.49	889.46	33	LLDELCK	biorepCdiffA_4
701	1052.23	3153.68	3152.60	46	LLDELCKEDTILATNTSSLSITEIASSTK	biorepCdiff_4
182	637.44	1272.87	1272.73	56	LVEVISGQLTSK	37A_4
503	1022.22	2042.43	2042.08	50	SINKVPVDVSESPGFVVNR	37_4
296	801.20	1600.39	1599.83	58	VPVDVSESPGFVVNR	37A_4
130	643.53	1285.05	1284.66	73	VTFDTVFELSK	biorepCdiffA_4
154	547.87	1093.73	1093.64	37	YRPHPLLAK	37_4

Matching Genes:

gi|115250079|emb|CAJ67899.1| (3-hydroxybutyryl-CoA dehydrogenase [Clostridium difficile 630])

Protein Group 30

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
523	21	9	8	37

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
368	794.28	1586.54	1585.88	27	AADPIVVLFGATSIGR	biorepCdiff_5
82	545.35	1088.69	1088.55	49	ATIDAGWLDK	37A_5
459	1139.17	2276.33	2276.15	74	ENLDILYELAEIIGGEVSGSR	37_5
219	771.99	1541.97	1541.87	63	ENVIQTVSLELLGK	37A_5
352	987.17	1972.33	1971.96	94	IHTGLTADCTGLAVAEDTK	37_5
118	629.63	1257.25	1256.69	69	MGNVLVVIEQR	biorepCdiffA_5
268	699.21	1396.40	1395.83	54	VLPELISQLSVAK	biorepCdiff_5
48	444.36	886.70	886.55	43	VSALLLGSK	37_5
183	637.10	1272.18	1271.65	50	YADVGIVGDVHK	biorepCdiff_5

Matching Genes:

gi|115250077|emb|CAJ67897.1| (electron transfer flavoprotein alpha-subunit [Clostridium difficile 630])

Protein Group 31

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
519	24	10	8	49

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
188	501.32	1000.62	1000.56	57	GTQAVGIVEK	37_3
203	518.37	1034.73	1034.65	43	IILLGPPGAGK	37_3
626	1037.80	2073.59	2073.07	67	IQVYLDETKPLVDYYSK	37_3
18	409.25	816.48	816.43	44	NAGISLDK	37_3
248	577.84	1153.67	1152.54	41	NGFMLDGFPR	37_3
159	585.86	1169.70	1168.53	29	NGFMLDGFPR +Oxidation (M)	37A_3
336	529.06	1584.16	1583.85	38	QGIIADIKGDQAIDK	37A_3
576	906.61	1811.20	1810.80	84	VEGVCDVCQGELYQR	37_3
138	458.31	914.60	914.51	60	VVNIEVDK	37_3
314	511.64	1531.89	1531.78	56	YNIPHISTGDIFR	37A_3

Matching Genes:

gi|115249098|emb|CAJ66909.1| (adenylate kinase [Clostridium difficile 630])

Protein Group 32

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
517	13	8	6	26

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
219	738.10	1474.18	1474.77	32	EEGIIFNTLTNPK	37A_6
496	1069.26	2136.51	2136.05	72	EGVFAGGDAVTGAATVISAMGAGK	37_6
155	593.89	1185.77	1185.60	61	LGSESYIVYR	37_6
116	611.32	1220.63	1220.50	39	MELGEPDDSGR +Oxidation (M)	37A_6
246	691.53	1381.05	1380.74	53	QAVVQPEIDNIR	biorepCdiff_6
372	864.16	1726.30	1725.91	101	VAVIGSGPAGLACAGDLAK	37_6
260	701.53	1401.04	1401.70	93	VAVVGGGNVAMDAAR +Oxidation (M)	37_6
349	989.19	1976.37	1975.92	66	VCPQESQCEGVCILGIK	37A_6

Matching Genes:

gi|115250578|emb|CAJ68402.1| (putative glutamate synthase [NADPH] small chain [Clostridium difficile 630])

Protein Group 33

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
516	17	8	7	29

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
247	831.49	1660.97	1660.76	63	AHCSTVGAGEFLQER	37A_5
430	1107.33	2212.65	2212.13	72	AQGYEVGTSLLEIDKVEYAK	37_5
358	839.17	1676.32	1675.81	99	EVVFAADDNVVGENAK	biorepCdiff_6
406	1064.86	2127.70	2127.18	60	FLGEAVANPVRPFTAILGGAK	37_5
245	766.11	1530.21	1529.88	38	LNGALPTIQYLISK	37_5
332	745.55	1489.08	1488.72	46	MENGDVVLLENTR	biorepCdiff_5
305	911.10	1820.19	1819.88	80	MTHVSTGGGASLEFLEGK	37_5
311	919.10	1836.18	1835.87	58	MTHVSTGGGASLEFLEGK +Oxidation (M)	37_5

Matching Genes:

gi|115252230|emb|CAJ70070.1| (phosphoglycerate kinase [Clostridium difficile 630])

Protein Group 34

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
509	20	9	6	26

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
86	561.01	1120.01	1119.58	45	FEGETLPSLK	biorepCdiffA_5
14	424.25	846.48	846.44	36	ILETTDR	37A_5
228	731.61	1461.20	1460.73	46	LGWTCASPEILSK	biorepCdiffA_5
152	613.01	1224.01	1223.55	34	LNYSNMPEEK	biorepCdiff_5
289	826.12	1650.22	1649.82	33	MIYVIPDFQNPTGR	biorepCdiffA_5
93	567.83	1133.65	1133.55	50	MQGLQGSEIR +Oxidation (M)	37A_5
296	896.62	1791.22	1791.87	69	QGADLQASTISQMEVSK	37_5
302	905.08	1808.15	1807.86	92	QGADLQASTISQMEVSK +Oxidation (M)	37_5
488	1204.36	2406.70	2406.20	104	TNVNKDDILVTSGSQQGLDFAGK	37_5

Matching Genes:

gi|115252729|emb|CAJ70573.1| (putative amino acid aminotransferase [Clostridium difficile 630])

Protein Group 35

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
487	15	8	7	16

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
111	621.48	1240.95	1240.61	28	AFDYVTQEIR	biorepCdiffA_6
247	531.96	1592.87	1592.78	40	AGTNMERPGPLAAHR +Oxidation (M)	37A_6
90	574.32	1146.63	1146.55	48	EEGELGSGITR	37A_6
685	1071.54	3211.61	3210.60	84	EEVVEETVEEAAPVSEAAVVPVSTGVAGETVK	37_6
212	647.92	1293.82	1293.65	69	IDKVEFADETK	37_6
516	809.07	1616.12	1615.81	103	IVLEENEQSLPMSK	37_3
352	817.00	1631.98	1631.81	75	IVLEENEQSLPMSK +Oxidation (M)	37A_3
96	479.81	957.60	957.51	40	NAIEGVEVK	37A_3

Matching Genes:

gi|115252300|emb|CAJ70141.1| (proline reductase subunit proprotein [Clostridium difficile 630])

Protein Group 36

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
480	9	8	7	8

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
131	636.81	1271.61	1271.60	53	AQANEPLTEDGK	37A_8
127	564.91	1127.80	1127.58	42	DIPNVGDSAIK	37_8
181	687.13	1372.24	1371.72	77	IGAEVDSGDILVGK	biorepCdiff_8
119	550.37	1098.72	1098.64	63	LISSTVIPNR	37_8
278	824.06	1646.11	1645.81	60	SNSGTCINQTPIINK	biorepCdiff_8
246	817.01	1632.00	1631.85	75	STGPYSLVTQQPLGGK	37A_8
240	723.46	1444.90	1444.70	79	VLTDEDQEIEVR	37_8
71	501.45	1000.89	1000.58	31	VTADEIIIK	biorepCdiff_8

Matching Genes:

gi|115249070|emb|CAJ66881.1| (DNA-directed RNA polymerase beta chain [Clostridium difficile 630])

Protein Group 37

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
479	25	7	6	39

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
602	946.20	1890.39	1889.90	85	EAEQAGADFVGAEELVQK	biorepCdiff_3
234	594.95	1187.89	1187.58	27	FDETVEAHIK	biorepCdiff_3
594	936.27	1870.53	1869.94	124	FYDASEALTLVSDIAGAK	biorepCdiff_3
492	790.63	1579.24	1578.83	73	LTENFTALMDAIIK	biorepCdiff_3
88	512.89	1023.76	1023.52	56	SGTVTFDVAK	biorepCdiffA_3
260	617.57	1233.13	1232.64	67	SITVASSMGPGVK	biorepCdiff_3
151	539.48	1076.94	1076.63	47	TNIIHVPVGK	biorepCdiff_4

Matching Genes:

gi|115249066|emb|CAJ66877.1| (50S ribosomal protein L1 [Clostridium difficile 630])

Protein Group 38

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
471	20	10	7	51

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
250	580.42	1158.82	1158.68	47	ALVFENVLVR	37_3
485	795.14	2382.40	2382.01	25	ASDSFNLEMHVDMEEGNAAGVK +2 Oxidation (M)	37A_3
665	789.75	2366.22	2366.02	63	ASDSFNLEMHVDMEEGNAAGVK +Oxidation (M)	37_3
38	415.78	829.54	829.47	44	EGVIVASR	37_3
144	565.84	1129.67	1129.56	52	ESGDIAGTPGVK	37A_3
555	891.69	1781.37	1780.85	58	FKPLSQPGQYACEEK	biorepCdiff_3
335	428.23	1281.67	1281.58	38	HIHMSNEDATK	37_3
21	428.38	854.74	854.52	39	LPIALSNK	biorepCdiffA_3
237	565.34	1128.67	1128.58	58	LVGPAGEVEMK	37_3
148	573.36	1144.70	1144.58	47	LVGPAGEVEMK +Oxidation (M)	37A_3

Matching Genes:

gi|115251734|emb|CAJ69569.1| (putative propanediol utilization protein [Clostridium difficile 630])

Protein Group 39

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
465	12	9	7	22

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
31	420.82	839.62	839.49	28	APSIPSLR	37_6
226	748.95	1495.88	1495.66	27	EMGDNCSVTILNK +Oxidation (M)	37A_6
304	918.13	1834.25	1833.82	60	GDDISYAGCGLPYYVGK	37A_6
477	813.57	2437.70	2437.15	54	LNGELDSVLLDEIEDFDSWTK	37_8
553	757.87	2270.58	2270.05	50	NSLTNKPTWSPMGSSANHEGR	37_6
435	763.28	2286.82	2286.04	53	NSLTNKPTWSPMGSSANHEGR +Oxidation (M)	biorepCdiffA_6
263	704.98	1407.94	1407.72	72	SSLIVNTPESFSK	37_6
329	793.02	1584.03	1583.77	73	TLSTGEKENLSYDK	37_6
215	731.95	1461.89	1461.82	48	VLEGGILFYPNLK	37A_6

Matching Genes:

gi|115250843|emb|CAJ68667.1| (putative pyridine nucleotide-disulfide oxidoreductase [Clostridium difficile 630])

Protein Group 40

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
446	15	8	6	26

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
370	1040.55	2079.09	2078.92	75	AAEETGLPYAGFDGDQADPR	37A_5
101	592.88	1183.74	1183.56	63	AFTNAQFETR	37A_5
150	652.02	1302.03	1301.66	40	IQGLVEVMEER	biorepCdiffA_5
48	455.77	909.53	909.46	34	KFEEVMK	37A_5
165	673.94	1345.87	1345.68	51	LLIEELEDNMK	37A_5
444	1118.74	2235.47	2235.02	30	RAAEETGLPYAGFDGDQADPR	37_5
686	1299.99	3896.96	3896.77	65	TNFGLLENGGCEALDMPAPDFLLCCNNICNQVIK	37_5
294	603.43	1807.28	1806.95	88	VVINDLLAEQYANAFK	37A_5

Matching Genes:

gi|115249403|emb|CAJ67218.1| (subunit of oxygen-sensitive 2-hydroxyisocaproyl-CoA dehydratase [Clostridium difficile 630])

Protein Group 41

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
446	13	8	5	22

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
189	624.93	1247.84	1248.59	26	AAIDMVSHSFR +Oxidation (M)	37_6
185	680.33	1358.64	1358.68	69	AFEGTLLAHTDGK	37A_6
62	443.78	885.55	885.42	27	INFDYSK	37_6
298	742.51	1483.01	1482.75	36	NMFALLGKPGYEK +Oxidation (M)	37_6
113	608.30	1214.59	1214.52	44	NYDKEEFDR	37A_6
411	1098.76	2195.50	2195.04	85	QLATEEGYETFVIPDDVGGR	37A_6
190	625.92	1249.83	1249.63	54	SGTTTEPALAFR	37_6
342	816.62	1631.23	1630.87	105	TGLGNTFLGWIDLPK	37_6

Matching Genes:

gi|115252341|emb|CAJ70182.1| (glucose-6-phosphate isomerase [Clostridium difficile 630])

Protein Group 42

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
443	17	8	7	27

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
41	479.51	957.00	956.55	46	AVELLLDGK	biorepCdiffA_4
190	428.88	1283.62	1283.55	32	CEEFKTEEGR	37A_4
490	781.26	2340.75	2340.16	52	GLLEEDLTEMNLSSVGDIIHR	37A_4
584	1179.47	2356.93	2356.16	63	GLLEEDLTEMNLSSVGDIIHR +Oxidation (M)	37_4
455	913.17	1824.32	1823.96	100	HSIIVLAEGVGSASDLEK	37_4
452	908.16	1814.30	1813.94	53	TIGLLTSGGDAPGMNAAIR	37_4
459	916.19	1830.36	1829.93	46	TIGLLTSGGDAPGMNAAIR +Oxidation (M)	37_4
85	504.85	1007.68	1007.59	51	VTVLGHVQR	37A_4

Matching Genes:

gi|115252455|emb|CAJ70298.1| (6-phosphofructokinase [Clostridium difficile 630])

Protein Group 43

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
433	14	9	5	13

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
270	789.53	1577.05	1576.73	97	CGTGLASHEVAQGYK	37_8
422	1179.69	2357.37	2357.08	44	ENFDQLFPADYISEGIDQTR	37A_8
348	1064.05	2126.08	2125.97	29	GNTVNPMELFDQYGADALR +Oxidation (M)	37A_8
360	571.43	1711.26	1710.88	49	KGDEVYYVSKPLADK	biorepCdiff_7
188	456.62	1366.83	1366.72	34	LNAHETANKLEK	37A_8
203	704.40	1406.79	1406.70	65	LTEELINEGYAR	37A_8
266	865.66	1729.30	1728.90	54	RYDLPVIQPVDETGK	37A_8
371	873.16	1744.31	1743.81	31	SLEEQNLNDHMTGIK +Oxidation (M)	biorepCdiff_7
189	456.62	1366.84	1366.64	30	VVHNYPHCWR	37A_8

Matching Genes:

gi|115251669|emb|CAJ69504.1| (isoleucyl-tRNA synthetase [Clostridium difficile 630])

Protein Group 44

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
431	22	6	6	30

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
375	616.54	1231.06	1230.61	44	AADDAAGLAISEK	biorepCdiff_1
324	837.07	1672.12	1671.87	52	IADELTQLKDEIER	37A_4
401	839.54	1677.06	1676.84	77	IRDTDVASEMVNLSK	37_4
160	535.31	1068.60	1068.51	43	ISSSTEFNGK	37A_1
452	1159.82	2317.62	2317.11	124	LESTQNNLNNTLENVTAAESR	biorepCdiffA_4
381	910.20	1818.39	1817.88	91	TLSLQSANEINNTEER	37A_4

Matching Genes:

gi|115249247|emb|CAJ67060.1| (flagellin subunit [Clostridium difficile 630])

Protein Group 45

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
422	15	8	5	24

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
396	903.16	1804.31	1803.94	72	AGFVVSDSNIKPDNTLK	37_6
340	815.67	1629.32	1628.81	50	EGFLYLAEAGADFVK	biorepCdiff_6
55	469.26	936.50	936.42	35	FDESPTNK	37A_6
238	672.49	1342.97	1342.72	79	GQATSIIEVAQAR	37_6
320	981.21	1960.40	1959.95	30	LSFEEGVDSYVPYAGSLK	biorepCdiffA_6
39	443.77	885.52	885.47	77	VGAGNVVDR	37A_6
503	1354.49	2706.97	2706.28	33	VPALVEAGADVLCIDSSEGFSEWQK	biorepCdiffA_6
305	918.61	1835.21	1834.85	46	VSEFMTPMSSIVYANK +2 Oxidation (M)	37A_6

Matching Genes:

gi|115251390|emb|CAJ69222.1| (inosine-5'-monophosphate dehydrogenase [Clostridium difficile 630])

Protein Group 46

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
418	11	8	4	18

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
338	805.58	1609.15	1608.80	87	INGVSVVSVESDNYK	37_6
409	919.64	1837.27	1836.84	93	KDEFLSYINSTDYDK	37_6
407	690.49	1378.97	1378.69	36	LGGISTDVPMSFR	37_3
78	549.89	1097.76	1097.71	38	LILAVTDIIK	37A_6
343	980.21	1958.40	1957.97	49	TLPVTYDDGTFAGIITMK +Oxidation (M)	37A_6
127	620.90	1239.79	1239.65	53	VDAPEILDNVR	37A_6
30	460.36	918.70	918.45	30	YALDYFK	biorepCdiffA_6
24	453.36	904.70	904.38	32	YAMDMFK	biorepCdiffA_6

Matching Genes:

gi|115249342|emb|CAJ67155.1| (manganese-dependent inorganic pyrophosphatase [Clostridium difficile 630])

Protein Group 47

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
418	16	8	5	45

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
600	978.18	1954.35	1953.98	101	AIANSDLGLNPSNDGEVIR	37_3
118	445.75	889.49	889.43	39	ANAQMLDK	37_3
75	459.76	917.51	917.51	34	EIDTLLSK	37A_3
44	435.25	868.48	868.44	41	FEFGTIR	37A_3
131	545.83	1089.64	1089.52	41	GGELTEDELK	37A_3
271	609.88	1217.74	1217.61	69	GGELTEDELKK	37_3
229	557.38	1112.75	1113.60	28	LSVPALTEER	37_3
487	1194.26	2386.50	2386.22	65	VDYYGTPTPINQIGAISVPEPR	37A_3

Matching Genes:

gi|115251191|emb|CAJ69022.1| (ribosome recycling factor [Clostridium difficile 630])

Protein Group 48

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
413	20	8	7	45

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
178	612.89	1223.78	1223.63	46	AGATYVSPFVGR	37A_3
55	425.30	848.58	848.46	40	DFIEVVK	37_3
453	722.52	2164.53	2164.13	67	EISEIVDGPISAEVISLEHK	37A_3
237	720.58	1439.14	1438.73	64	FFIDTANIEEIK	biorepCdiffA_3
97	480.28	958.55	958.52	49	IPMTAEGLK	37A_3
135	558.35	1114.68	1114.61	40	MGADIATVPLK	37A_3
232	559.90	1117.78	1117.64	36	NPIHVLQAAR	37_3
552	873.61	1745.21	1744.98	71	TNVTLIFSAGQALLAAR	37_3

Matching Genes:

gi|115251384|emb|CAJ69216.1| (putative transaldolase [Clostridium difficile 630])

Protein Group 49

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
402	13	7	6	50

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
184	595.37	1188.72	1188.60	42	DENIKNESIK	37A_2
217	510.29	1018.57	1018.57	54	EIISSITTR	37_2
427	680.38	1358.74	1358.69	80	IECQGEGLVNLK	37_2
192	605.89	1209.77	1209.63	69	LSEVVEFYPK	37A_2
494	734.55	1467.08	1466.87	79	LVNDVELVNVLIK	37_2
394	664.86	1327.71	1327.70	48	NVPVNIWPYAR	37_2
252	566.78	1131.55	1131.49	30	YECEEFKK	37_2

Matching Genes:

gi|115249997|emb|CAJ67817.1| (hypothetical phage protein [Clostridium difficile 630])

Other Genes Matching Peptide Subset:

gi|115251944|emb|CAJ69780.1| (hypothetical phage protein [Clostridium difficile 630])

Protein Group 50

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
398	18	7	7	50

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
51	457.46	912.90	912.56	52	AVLELAGLK	biorepCdiffA_3
607	637.43	1909.27	1909.01	41	FAALVVVGDENGHVGIGAGK	biorepCdiff_3
738	1231.92	2461.82	2461.29	68	GHFGAGNILIMPAVEGTGVIAGGPAR	biorepCdiff_3
739	1240.02	2478.03	2477.28	56	GHFGAGNILIMPAVEGTGVIAGGPAR +Oxidation (M)	biorepCdiff_3
435	728.08	1454.15	1453.78	72	KPIDAGQLDLQEK	biorepCdiff_3
584	929.39	1856.77	1856.09	57	NLIVVPIVGTTIPHEVR	biorepCdiff_3
538	537.79	1610.35	1609.88	52	RKPIDAGQLDLQEK	biorepCdiff_2

Matching Genes:

gi|115249094|emb|CAJ66905.1| (30S ribosomal protein S5 [Clostridium difficile 630])

Protein Group 51

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
396	17	7	4	41

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
340	797.14	1592.26	1591.86	105	APVSNFAYLIDAIAK	37A_3
209	687.46	1372.91	1372.76	56	GLTVEEVTELRK	biorepCdiffA_3
113	565.50	1128.99	1128.60	30	IVEMANIPSR	biorepCdiffA_3
221	573.39	1144.77	1144.59	39	IVEMANIPSR +Oxidation (M)	biorepCdiff_3
432	723.50	1444.99	1444.65	37	MGIVEGAFYDESK	biorepCdiff_3
137	559.80	1117.58	1117.59	41	SEVVSEIVEK	37A_3
191	520.04	1038.08	1037.54	88	SSAAVVVDYK	biorepCdiff_3

Matching Genes:

gi|115249067|emb|CAJ66878.1| (50S ribosomal protein L10 [Clostridium difficile 630])

Protein Group 52

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
391	15	7	6	30

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
171	607.91	1213.81	1213.67	79	AGENLLSLLER	37A_3
489	783.04	1564.07	1564.81	72	QLVTHGHFTLNGNK	biorepCdiff_3
202	517.85	1033.69	1033.57	37	RLDNVVYR	37_3
74	492.40	982.79	982.61	40	VDIPSLIVK	biorepCdiffA_3
206	525.33	1048.64	1048.57	62	VSNYGLQLR	37_3
364	675.01	1348.01	1347.65	58	WLEANVEGMTAK	biorepCdiff_3
374	683.00	1363.98	1363.64	43	WLEANVEGMTAK +Oxidation (M)	biorepCdiff_3

Matching Genes:

gi|115249105|emb|CAJ66916.1| (30S ribosomal protein S4 [Clostridium difficile 630])

Protein Group 53

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
383	14	7	6	68

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
1	402.70	803.38	803.40	42	ACVEVAR	37_1
701	1185.92	3554.74	3553.83	68	AGNLLFVSGQVPLVPETMEVVEGDVQAQTAQSLK	37_2
702	1191.26	3570.77	3569.83	78	AGNLLFVSGQVPLVPETMEVVEGDVQAQTAQSLK +Oxidation (M)	37_2
709	1332.70	2663.38	2663.20	74	DMNEFGAINEVYAEYFGENKPAR	37_1
764	1116.90	2231.78	2231.13	46	HEVIHTNDAPAALGPYSQAIK	biorepCdiff_1
467	1246.38	2490.75	2490.27	32	MKHEVIHTNDAPAALGPYSQAIK	biorepCdiffA_1
693	836.54	2506.59	2506.26	43	MKHEVIHTNDAPAALGPYSQAIK +Oxidation (M)	37_1

Matching Genes:

gi|115251566|emb|CAJ69399.1| (putative translation inhibitor endoribonuclease [Clostridium difficile 630])

Protein Group 54

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
377	8	7	6	28

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
415	696.98	1391.94	1391.77	61	GYLVSNKEELLK	37_3
249	579.35	1156.68	1156.56	51	ICCSYTLIK	37_3
39	429.82	857.63	857.52	40	KIEEIVK	37A_3
270	703.20	1404.38	1403.65	36	MDQNLNWLNEK	37A_3
436	710.92	1419.83	1419.65	53	MDQNLNWLNEK +Oxidation (M)	37_3
162	473.28	944.54	944.47	65	TIAAPANCK	37_3
275	712.42	1422.82	1422.62	71	TTGICIDCSSPGR	37A_3

Matching Genes:

gi|115251115|emb|CAJ68946.1| (conserved hypothetical protein [Clostridium difficile 630])

Protein Group 55

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
372	15	6	6	34

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
438	699.59	1397.17	1396.76	63	AEIGLTYIYGIGK	biorepCdiff_2
163	458.23	914.44	914.45	44	AEINPDTR	37_2
168	659.40	1316.78	1316.62	69	DLSEDQVNELR	biorepCdiffA_2
238	723.50	1444.99	1444.72	45	DLSEDQVNELRK	biorepCdiffA_2
25	420.86	839.70	839.49	62	IAGVDLPR	biorepCdiffA_2
526	780.05	1558.08	1557.80	89	IKDLSEDQVNELR	biorepCdiff_2

Matching Genes:

gi|115249103|emb|CAJ66914.1| (30S ribosomal protein S13 [Clostridium difficile 630])

Protein Group 56

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
358	16	7	4	38

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
436	670.23	2007.66	2007.14	43	GVVIPVTAVEAGPMVVTQIK	biorepCdiffA_3
642	1012.89	2023.77	2023.14	33	GVVIPVTAVEAGPMVVTQIK +Oxidation (M)	biorepCdiff_3
10	416.84	831.66	831.47	32	IDVTGISK	biorepCdiffA_3
630	992.75	1983.49	1982.96	66	TVDKDGYNAIQIGFEDAK	biorepCdiff_3
311	762.46	1522.91	1522.75	89	VDSVEGYTVGQEIK	37A_3
116	570.39	1138.77	1138.57	68	VGMTQIFTDK	biorepCdiffA_3
163	565.09	1128.16	1127.65	27	VTVQNLEVVK	biorepCdiff_4

Matching Genes:

gi|115249077|emb|CAJ66888.1| (50S ribosomal protein L3 [Clostridium difficile 630])

Protein Group 57

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
355	9	7	5	16

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
120	615.90	1229.78	1229.60	42	HVFEGESNIAK	37A_6
371	864.15	1726.29	1725.92	71	ITLPTASESFLYGISK	37_6
243	788.48	1574.94	1574.86	30	KIGIEAEIVPYESK	37A_6
92	579.31	1156.61	1156.51	33	NEMIESAYGK +Oxidation (M)	37A_6
108	518.37	1034.73	1034.55	46	QALSYALNR	biorepCdiff_6
91	480.31	958.60	958.51	48	QIQQDISK	37_6
362	846.55	1691.08	1690.74	85	SNSNLQTYTYSEER	37_6

Matching Genes:

gi|115251723|emb|CAJ69558.1| (oligopeptide ABC transporter, substrate-binding protein [Clostridium difficile 630])

Protein Group 58

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
352	13	6	4	34

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
343	870.67	1739.32	1738.88	105	AAALDTFETEGLFLNK	37A_4
162	560.87	1119.73	1119.58	25	DYEEPVIKK	37_4
405	844.11	1686.21	1685.88	71	GGLINTGDLIEALESGK	37_4
536	1321.24	2640.46	2640.31	65	GLGANVIAFDQYPNSDLNDILTYK	37A_4
616	1354.90	2707.79	2707.30	61	GYDGISIQQTNYIDNPYIYETLK	37_7
565	973.74	2918.21	2917.34	25	WSEEHKDVQVDIYPENMTEENVVK	37A_5

Matching Genes:

gi|115249400|emb|CAJ67215.1| ((R)-2-hydroxyisocaproate dehydrogenase [Clostridium difficile 630])

Protein Group 59

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
348	15	6	5	48

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
247	556.34	1110.66	1110.64	51	ADLDLRPALK	37_2
355	823.55	1645.08	1644.81	60	ALENYFNYETLIR	37A_2
251	564.78	1127.55	1127.54	43	ANVQYYGTGR	37_2
252	656.47	1310.93	1310.73	108	LVAGEGNILVNGR	37A_2
123	606.93	1211.84	1211.65	37	QPLVLTGNENK	biorepCdiffA_2
376	965.73	1929.45	1929.06	49	QPLVLTGNENKYDVIVK	biorepCdiffA_2

Matching Genes:

gi|115249113|emb|CAJ66924.1| (30S ribosomal protein S9 [Clostridium difficile 630])

Protein Group 60

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
339	21	7	6	40

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
483	733.18	1464.34	1463.75	41	FENGTEITAELLK	biorepCdiff_2
193	486.85	971.69	971.53	46	ILGEGNLEK	biorepCdiff_2
378	440.29	1317.84	1318.74	45	LHELKPAEGAVR	37_2
536	532.38	1594.11	1593.87	30	MKLHELKPAEGAVR +Oxidation (M)	biorepCdiff_2
225	631.39	1260.76	1260.63	70	VGFEGGQMPLAR	37A_2
320	639.47	1276.93	1276.62	51	VGFEGGQMPLAR +Oxidation (M)	biorepCdiff_2
234	718.06	1434.11	1433.75	56	VYTEVNVEVLNR	biorepCdiffA_2

Matching Genes:

gi|115249096|emb|CAJ66907.1| (50S ribosomal protein L15 [Clostridium difficile 630])

Protein Group 61

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
336	13	7	5	31

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
77	494.49	986.97	986.51	32	EVAPALMEK	biorepCdiffA_3
235	598.51	1195.01	1194.63	45	GMDIIFVTTAK	biorepCdiff_3
381	929.78	1857.55	1856.99	60	GVEELEMISGQKPVITK	biorepCdiffA_3
596	937.80	1873.58	1872.99	50	GVEELEMISGQKPVITK +Oxidation (M)	biorepCdiff_3
120	579.95	1157.89	1157.62	63	IVINMGIGDAR	biorepCdiffA_3
124	587.98	1173.94	1173.62	39	IVINMGIGDAR +Oxidation (M)	biorepCdiffA_3
31	435.92	869.82	869.53	47	LVSVSLPR	biorepCdiffA_3

Matching Genes:

gi|115249089|emb|CAJ66900.1| (50S ribosomal protein L5 [Clostridium difficile 630])

Protein Group 62

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
336	15	6	5	52

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
412	664.33	1326.65	1326.62	76	HETVDVPASNMK	37_1
105	545.46	1088.91	1088.62	46	ILLEEGFIR	biorepCdiffA_1
274	777.10	1552.19	1551.74	29	KENVGGEVICYVW	biorepCdiffA_2
191	683.02	1364.02	1363.65	53	TMTDPIADMLTR	biorepCdiffA_1
200	694.55	1387.09	1386.81	72	VLNGLGISVISTSK	biorepCdiffA_1
186	571.43	1140.84	1140.59	60	VYAANHEIPK	37A_1

Matching Genes:

gi|115249091|emb|CAJ66902.1| (30S ribosomal protein S8 [Clostridium difficile 630])

Protein Group 63

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
335	19	8	4	22

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
234	669.44	1336.86	1336.61	59	DTDPQSALEYAK	37_6
476	1041.81	2081.60	2080.97	25	EVQASMDEIGVGEFATVSGR	37_6
517	940.17	2817.49	2816.35	28	IVELGGSAIITADHGNAEYMLDPETGK +Oxidation (M)	37A_6
368	572.40	1714.17	1713.86	47	LEKPEEMTGHSLISK +Oxidation (M)	37_6
472	1037.77	2073.53	2073.00	66	VATYDLKPEMSAYELTDK	37_6
482	1045.73	2089.44	2088.99	39	VATYDLKPEMSAYELTDK +Oxidation (M)	37_6
81	583.46	1164.91	1164.60	30	VELAYNAMVR	biorepCdiffA_6
91	575.77	1149.52	1149.52	41	VLCEAMDNAK	37A_6

Matching Genes:

gi|115252228|emb|CAJ70068.1| (2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Clostridium difficile 630])

Protein Group 64

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
319	11	6	4	54

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
383	652.87	1303.72	1303.63	75	EGASKEEADQIK	37_1
115	436.23	870.44	870.44	37	EVVDNAPK	37_1
412	1073.31	2144.60	2144.06	39	FGVSASAPVMVAGAAAGGPAAEEK	biorepCdiffA_1
475	721.26	2160.76	2160.05	55	FGVSASAPVMVAGAAAGGPAAEEK +Oxidation (M)	37A_1
602	749.20	1496.39	1495.74	67	TEFDVVLTDVGSSK	biorepCdiff_1
92	528.89	1055.76	1055.62	46	VLELNELVK	biorepCdiffA_1

Matching Genes:

gi|115249068|emb|CAJ66879.1| (50S ribosomal protein L7/L12 [Clostridium difficile 630])

Protein Group 65

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
319	12	6	5	17

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
146	581.90	1161.79	1161.59	53	FPLDTEAELK	37_6
365	1047.36	2092.70	2092.14	48	HVENITQVYGLPAVVAINR	biorepCdiffA_6
581	1206.32	2410.64	2410.15	50	IYGADGVDYTPEADKEIANLEK	37_6
440	969.73	1937.46	1936.99	65	LGNIIVGYSYEGEPVTAR	37_6
246	857.14	1712.27	1711.87	65	SDIEIAQEAKPQDIR	biorepCdiffA_6
214	648.44	1294.86	1294.68	38	TTTTIGVADAFAK	37_6

Matching Genes:

gi|115249735|emb|CAJ67552.1| (formate--tetrahydrofolate ligase [Clostridium difficile 630])

Protein Group 66

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
317	12	7	4	12

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
127	572.97	1143.93	1143.57	32	APESLIEEEK	biorepCdiff_7
348	543.37	1627.10	1626.77	41	IKEHNHNVGTCYR	37_7
109	490.80	979.59	979.46	59	LYGEDANAK	37_7
522	1122.87	2243.73	2243.14	77	SLGNGIDPLEIIEQYGADALR	37_7
457	824.53	2470.58	2470.10	33	TTLSDAEVEHEEHDGNFYHIK	37A_7
237	668.52	1335.02	1334.70	43	TYLQWLENIR	37_7
491	1338.56	2675.11	2675.09	32	YNEEDNMAEEEDMMNLLMEGIR	biorepCdiffA_7

Matching Genes:

gi|115252312|emb|CAJ70153.1| (valyl-tRNA synthetase [Clostridium difficile 630])

Protein Group 67

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
304	11	6	2	15

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
307	638.89	1913.64	1912.98	35	AIGDNLTCIFVDHGLLR	biorepCdiffA_6
315	774.49	1546.97	1546.66	73	AVTSSDGMTSDWYK	37_6
65	445.82	889.63	889.50	38	FDINLIR	37_6
507	1084.31	2166.61	2166.08	98	GIIFTGGPNSAYLEDSPTISK	37_6
88	488.87	975.73	975.54	30	IIGEEFIR	biorepCdiff_6
101	490.28	978.55	978.44	30	TVGVMGDER +Oxidation (M)	37_6

Matching Genes:

gi|115249206|emb|CAJ67019.1| (GMP synthase [glutamine-hydrolyzing] [Clostridium difficile 630])

Protein Group 68

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
304	7	5	3	23

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
372	901.63	1801.24	1801.01	92	ILFVAGGVGSAPVYPQVK	37A_4
75	588.95	1175.90	1175.62	48	IPLTIADYDR	biorepCdiffA_4
354	882.98	1763.94	1763.78	98	NVYVSTDDGTYGFNGR	37A_4
436	593.90	1778.67	1777.89	31	QLTDSIYLMEIEAPR	biorepCdiff_4
134	609.37	1216.72	1216.68	35	SSQPGQFIIIK	37A_4

Matching Genes:

gi|115250577|emb|CAJ68401.1| (putative dehydrogenase, electron transfer subunit [Clostridium difficile 630])

Protein Group 69

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
297	7	6	5	22

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
59	501.97	1001.93	1001.55	51	FVIEPLER	biorepCdiffA_5
252	707.49	1412.97	1412.74	81	LEELGLGLKPSEE	37A_4
71	473.78	945.54	944.52	44	SLEEVIQK	37A_4
539	1085.76	2169.50	2169.16	46	TENVPIGVLPVDSIYTPVEK	37_4
167	669.64	1337.27	1336.65	28	VDIVELSEDYR	biorepCdiffA_5
106	552.79	1103.57	1103.54	47	VSYHVENTR	37A_4

Matching Genes:

gi|115249106|emb|CAJ66917.1| (DNA-directed RNA polymerase alpha chain [Clostridium difficile 630])

Protein Group 70

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
295	9	6	5	31

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
651	904.08	2709.23	2708.25	42	KTEGLQDTQTHYCPGCTHGIIHR	biorepCdiff_4
679	976.91	2927.70	2926.57	40	LVGEVLEELGVLGDAVGVVPVGCSVLGYK	biorepCdiff_4
245	574.83	1147.66	1147.56	53	NAETQGYPIR	37_3
161	473.27	944.53	944.48	35	NVEVEEVK	37_3
497	861.42	2581.23	2580.16	64	TEGLQDTQTHYCPGCTHGIIHR	biorepCdiffA_4
211	532.84	1063.66	1063.58	61	VAVDTPAHVR	37_3

Matching Genes:

gi|115249126|emb|CAJ66937.1| (putative subunit of oxidoreductase [Clostridium difficile 630])

Protein Group 71

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
284	14	6	6	28

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
469	756.62	1511.23	1510.87	51	ALVVIADKNDNVIK	biorepCdiff_3
243	723.47	1444.92	1444.77	43	EFAQILNNINAAK	biorepCdiffA_3
700	1118.32	2234.62	2234.16	57	NIEGVQTALVNTMNVYDILK	biorepCdiff_3
505	1126.40	2250.79	2250.16	49	NIEGVQTALVNTMNVYDILK +Oxidation (M)	biorepCdiffA_3
328	838.19	1674.37	1673.91	44	TKEFAQILNNINAAK	biorepCdiffA_3
208	687.05	1372.08	1371.69	40	YDSFIITTDAVK	biorepCdiffA_3

Matching Genes:

gi|115249078|emb|CAJ66889.1| (50S ribosomal protein L4 [Clostridium difficile 630])

Protein Group 72

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
280	8	5	5	15

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
123	618.38	1234.75	1234.64	70	GKETVISTADSK	37_5
55	465.31	928.61	928.56	56	IGIEGSILK	37A_5
199	646.11	1290.21	1289.70	53	ILVLNCGSSSLK	biorepCdiff_5
244	822.59	1643.17	1642.88	54	MLLIPTNEELMIAR	37A_5
245	827.47	1652.92	1651.75	47	YGFHGTSHNYVSQR	37A_5

Matching Genes:

gi|115250207|emb|CAJ68028.1| (acetate kinase [Clostridium difficile 630])

Protein Group 73

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
280	10	6	5	21

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
348	864.64	1727.26	1726.88	50	EGITSVGENKPQELAR	biorepCdiffA_3
106	494.36	986.70	986.60	37	EITLLAVTK	37A_3
586	934.13	1866.24	1865.85	60	GLMTMAPFIEDEDEIR	37_3
418	950.12	1898.22	1897.84	42	GLMTMAPFIEDEDEIR +2 Oxidation (M)	37A_3
592	942.14	1882.26	1881.85	47	GLMTMAPFIEDEDEIR +Oxidation (M)	37_3
172	483.28	964.55	964.50	44	VGTSIFGER	37_3

Matching Genes:

gi|115251674|emb|CAJ69509.1| (putative alanine racemase [Clostridium difficile 630])

Protein Group 74

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
276	12	5	4	39

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
336	734.07	1466.12	1465.78	63	AGSQVSGPVPLPTEK	37A_1
274	798.09	1594.17	1593.87	72	KAGSQVSGPVPLPTEK	biorepCdiffA_1
164	541.43	1080.84	1080.62	67	LIDIANPTPK	37A_1
25	425.91	849.80	849.46	41	LLDFSAGK	biorepCdiffA_1
11	415.17	828.33	827.52	33	QVVTILR	biorepCdiffA_1

Matching Genes:

gi|115249076|emb|CAJ66887.1| (30S ribosomal protein S10 [Clostridium difficile 630])

Protein Group 75

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
275	10	5	4	14

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
169	613.46	1224.90	1224.65	71	DAVGQSVHTIAK	37_6
327	788.06	1574.10	1574.66	53	EFECYTQEQVDK	37_6
134	422.58	1264.73	1264.65	31	GHSVSIHSNTVK	37A_6
98	586.35	1170.68	1170.61	43	IAGVEIPEDTK	37A_6
390	890.96	1779.91	1780.95	77	IIVIEADGPGEEDIIAK	37_6

Matching Genes:

gi|115251397|emb|CAJ69229.1| (succinate-semialdehyde dehydrogenase [NAD(P)+] [Clostridium difficile 630])

Protein Group 76

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
262	14	5	3	28

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
481	776.00	1549.98	1549.72	39	EVSWLPSYGPEMR	37_3
489	784.00	1565.99	1565.72	33	EVSWLPSYGPEMR +Oxidation (M)	37_3
221	538.36	1074.70	1074.57	67	FKDDVIPGGK	37_3
128	493.85	985.68	985.62	59	IIVNSSLIK	37A_2
477	770.90	2309.69	2309.11	64	TDVDVYYIPANELAAELGNDK	37A_3

Matching Genes:

gi|115249127|emb|CAJ66938.1| (putative subunit of oxidoreductase [Clostridium difficile 630])

Protein Group 77

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
261	6	5	4	23

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
172	578.84	1155.66	1155.52	66	FFEGDIEGSR	37_4
116	573.40	1144.78	1144.59	39	HFETIANSVK	37A_4
214	628.04	1254.07	1253.75	46	LPIILYNVPGR	biorepCdiff_4
366	761.21	1520.41	1519.78	61	TAMNLLGFNVGDLR	biorepCdiff_4
509	824.28	2469.81	2469.18	49	VPVIAGSGSNDTMHSVNLSQEAEK	37A_4

Matching Genes:

gi|115252282|emb|CAJ70123.1| (dihydrodipicolinate synthase [Clostridium difficile 630])

Protein Group 78

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
257	11	5	4	34

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
640	703.25	2106.72	2105.99	80	MPDLNAASVEAAMSMIAGTAR	biorepCdiff_2
652	713.98	2138.92	2137.98	48	MPDLNAASVEAAMSMIAGTAR +2 Oxidation (M)	biorepCdiff_2
634	1045.88	2089.74	2089.09	43	TADQAGMIIPVVITVYQDR	biorepCdiff_2
637	1053.88	2105.74	2105.08	33	TADQAGMIIPVVITVYQDR +Oxidation (M)	biorepCdiff_2
161	455.30	908.59	908.57	53	TPPAAVLIK	37_2

Matching Genes:

gi|115249065|emb|CAJ66876.1| (50S ribosomal protein L11 [Clostridium difficile 630])

Protein Group 79

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
255	8	4	4	46

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
243	515.26	1028.51	1028.55	70	IANGEIPSTK	37_1
276	567.26	1132.51	1132.55	52	KLPNYEAGQN	37_1
340	738.99	1475.97	1475.67	87	VINNCGSDGGQEVK	37A_1
483	740.55	2218.63	2218.25	46	VLAFNDLNPVAPYHILVVPK	37A_1

Matching Genes:

gi|115251501|emb|CAJ69334.1| (histidine triad nucleotide-binding protein [Clostridium difficile 630])

Protein Group 80

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
254	9	5	4	14

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
367	1035.24	2068.47	2067.97	68	GGPGLGSIQPSQADYFMSTR	37A_5
386	1043.17	2084.32	2083.96	33	GGPGLGSIQPSQADYFMSTR +Oxidation (M)	37_5
124	632.50	1262.98	1262.65	63	VMTSSSSPGVALK	biorepCdiffA_5
208	640.41	1278.80	1278.65	41	VMTSSSSPGVALK +Oxidation (M)	37_7
442	1154.31	2306.61	2306.13	49	YFFGYPITPQSELPEYLSR	37A_5

Matching Genes:

gi|115249125|emb|CAJ66936.1| (putative oxidoreductase, thiamine diP-binding subunit [Clostridium difficile 630])

Protein Group 81

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
252	11	5	4	18

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
155	661.40	1320.79	1320.66	33	AVQLHGGYGYTR	37A_5
197	733.49	1464.96	1464.73	48	DLGKPYGVEAAMAK +Oxidation (M)	37A_5
97	578.86	1155.71	1155.64	57	HLVYQAAINK	37A_5
344	647.18	1938.53	1938.08	65	IGIAAQALGLAQGALDETVK	37_5
214	763.00	1523.99	1523.75	49	ITEIYEGTSEVQR	37A_5

Matching Genes:

gi|115250075|emb|CAJ67895.1| (butyryl-CoA dehydrogenase [Clostridium difficile 630])

Protein Group 82

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
252	16	5	4	23

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
162	634.47	1266.93	1266.73	50	ALVPVVVEQTGR	biorepCdiffA_3
111	563.42	1124.83	1124.52	34	DNFMSALEAK	biorepCdiffA_3
239	602.43	1202.85	1202.61	45	ETLNEILSER	biorepCdiff_3
356	657.40	1312.78	1312.66	58	EYGLIDEVFTK	37_3
441	482.31	1443.92	1443.79	65	IKETLNEILSER	37_3

Matching Genes:

gi|115252361|emb|CAJ70202.1| (ATP-dependent Clp protease proteolytic subunit [Clostridium difficile 630])

Protein Group 83

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
244	11	5	3	51

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
476	713.94	1425.87	1426.66	67	AHNDANMLSLGER	37_2
262	591.84	1181.67	1181.57	27	CAVVSDVFSAK	37_2
236	541.31	1080.61	1080.57	58	EIISYLESK	37_2
771	1159.86	3476.55	3475.61	60	GIECVDYGTNNATDSVDYPVYGEIVANSVINK	biorepCdiff_2
297	702.33	1402.65	1402.67	32	IGLGCDHGGYNLK	37A_2

Matching Genes:

gi|115252540|emb|CAJ70383.1| (ribose-5-phosphate isomerase 2 [Clostridium difficile 630])

Protein Group 84

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
243	9	6	2	23

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
336	962.17	1922.33	1921.92	69	AEGIEATEEEFKAELEK	37A_6
406	1092.27	2182.52	2182.05	52	ELDIDPIDNPDLDIEEISK	37A_6
492	873.10	2616.28	2616.20	25	ELSALDDEFAKDTSEFDSLDELK	37A_6
676	1312.88	2623.74	2624.31	35	GENYNLVIGSNTFIPGFEEQLVGK	biorepCdiff_6
56	525.48	1048.94	1049.58	30	IVIETQYGK	biorepCdiffA_6
14	433.93	865.85	865.44	32	YNIPGFR	biorepCdiffA_6

Matching Genes:

gi|115252362|emb|CAJ70203.1| (trigger factor [Clostridium difficile 630])

Protein Group 85

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
239	8	5	3	27

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
93	437.77	873.53	873.48	28	AVIIDESK	37_3
77	460.33	918.64	918.52	41	FEILEIR	37A_3
79	465.79	929.57	929.48	49	ISNESPVGK	37A_3
112	501.81	1001.61	1001.58	83	KAVIIDESK	37A_3
456	696.24	2085.69	2084.99	38	VAISFGDLSENAEYDEAKK	biorepCdiffA_3

Matching Genes:

gi|115252616|emb|CAJ70459.1| (transcription elongation factor [Clostridium difficile 630])

Protein Group 86

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
235	8	3	3	24

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
429	706.95	1411.88	1411.68	83	QNFGQVSNSYIR	37_3
639	1081.71	2161.41	2160.97	82	TGEGDGDDEEILVNLETMPK	37_3
564	887.59	1773.17	1772.86	70	VEKDEDFIFYNNLK	37_3

Matching Genes:

gi|115250676|emb|CAJ68500.1| (tellurium resistance protein [Clostridium difficile 630])

Protein Group 87

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
232	9	5	4	31

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
255	573.83	1145.65	1145.58	58	ETEGEIEVLK	37_2
598	1038.65	2075.29	2075.03	48	EYLPQQLSEEELEEIVK	37_2
96	458.34	914.66	914.59	29	KSVVTLIR	37A_2
191	605.88	1209.74	1209.59	56	STISEVGATSMK	37A_2
283	613.83	1225.65	1225.59	41	STISEVGATSMK +Oxidation (M)	37_2

Matching Genes:

gi|115251499|emb|CAJ69332.1| (putative tRNA binding protein [Clostridium difficile 630])

Protein Group 88

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
231	6	5	2	8

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
511	1072.96	2143.91	2143.00	35	ADLVTGMVGEFDELQGFMGK	biorepCdiff_7
245	674.43	1346.85	1346.69	74	AESDKIDESLLK	37_7
30	430.95	859.89	859.48	50	FAGDILPK	biorepCdiff_7
117	558.50	1114.98	1114.58	39	LADALFFYR	biorepCdiff_7
113	498.33	994.65	994.50	33	NLESYIEK	37_7

Matching Genes:

gi|115251485|emb|CAJ69318.1| (glycyl-tRNA synthetase beta chain [Clostridium difficile 630])

Protein Group 89

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
228	7	4	3	11

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
296	899.69	1797.36	1796.95	32	AMDLLVPGVGEIVGGSQR	37A_6
138	638.90	1275.78	1275.64	45	ITTMDLNDIPK +Oxidation (M)	37A_6
100	489.35	976.69	976.53	55	IVNSEFIR	37_6
282	869.55	1737.09	1736.85	96	SIVVEGESDSSYPLQK	37A_6

Matching Genes:

gi|115251299|emb|CAJ69130.1| (asparaginyl-tRNA synthetase [Clostridium difficile 630])

Protein Group 90

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
224	15	4	4	52

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
614	1018.15	2034.29	2034.06	56	EQPQIAEVVEVGPGGIVEGK	37_1
130	610.94	1219.87	1220.64	65	IEGQEYTILR	biorepCdiffA_2
180	454.71	907.40	907.43	42	MELTVGDK +Oxidation (M)	37_1
165	542.87	1083.72	1083.63	61	TASGIVLPGAAK	37A_1

Matching Genes:

gi|115249203|emb|CAJ67015.1| (10 kDa chaperonin [Clostridium difficile 630])

Protein Group 91

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
220	7	4	3	37

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
510	1031.34	3091.01	3091.55	62	KGEFFCSEAVLQTINDALGQPLSPEITK	biorepCdiffA_2
227	530.34	1058.67	1058.61	56	LASGFPIGLGK	37_2
226	529.28	1056.55	1056.49	34	NISEEYFR	37_2
421	677.39	1352.76	1352.55	68	WDGDNFMSPER	37_2

Matching Genes:

gi|115252075|emb|CAJ69912.1| (conserved hypothetical protein [Clostridium difficile 630])

Protein Group 92

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
220	7	4	4	10

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
319	777.56	1553.11	1552.73	51	EAYPGDVFYLHSR	37_6
180	676.45	1350.88	1350.79	61	IVEVPVGEALIGR	37A_6
233	770.51	1539.01	1538.81	49	TRPVESEAPGIIDR	37A_6
170	613.91	1225.80	1225.67	59	VVNSLGQPIDGK	37_6

Matching Genes:

gi|115252530|emb|CAJ70373.1| (ATP synthase alpha chain [Clostridium difficile 630])

Protein Group 93

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
215	9	4	3	20

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
595	962.14	1922.26	1922.00	73	FPEYAAEVLSTVVEQIK	37_3
166	476.31	950.61	951.59	44	LPVVKPGSR	37_3
325	780.53	1559.04	1558.78	64	TNHDIGMPIYSAIK	37A_3
495	788.52	1575.02	1574.78	34	TNHDIGMPIYSAIK +Oxidation (M)	37_3

Matching Genes:

gi|115249197|emb|CAJ67009.1| (orotate phosphoribosyltransferase [Clostridium difficile 630])

Protein Group 94

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
212	6	5	2	11

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
212	534.76	1601.26	1600.80	30	DLEEYLHLLEEAK	biorepCdiffA_7
585	1242.40	2482.79	2482.19	49	EALEELGLPYTINEGDGAFYGPK	37_7
544	1125.33	2248.64	2248.13	36	ELGLFMIPEEGPGFPMFLPK	biorepCdiff_7
88	551.80	1101.59	1101.54	65	EVADNNVSVR	37A_7
33	418.82	835.63	835.46	32	GPHLPSTK	37_7

Matching Genes:

gi|115249589|emb|CAJ67406.1| (threonyl-tRNA synthetase [Clostridium difficile 630])

Protein Group 95

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
211	4	3	3	14

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
399	937.30	1872.59	1872.01	79	EGLLNEDVILESITSIK	37A_4
543	730.91	2189.72	2189.16	60	VNVEDLIYPLFVVEGENIK	37_4
153	619.41	1236.81	1236.56	72	YASNYYGPFR	37A_4

Matching Genes:

gi|115252479|emb|CAJ70322.1| (delta-aminolevulinic acid dehydratase [Clostridium difficile 630])

Protein Group 96

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
208	6	3	2	28

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
412	905.24	1808.46	1807.91	91	SIMGIMSLGLAQGEELK +2 Oxidation (M)	37A_1
582	896.58	1791.14	1791.91	86	SIMGIMSLGLAQGEELK +Oxidation (M)	37_1
37	416.83	831.65	831.47	31	STVEVVAK	37A_1

Matching Genes:

gi|115251809|emb|CAJ69644.1| (PTS system, phosphocarrier protein [Clostridium difficile 630])

Protein Group 97

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
207	7	5	3	19

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
263	654.86	1307.71	1307.60	57	AATPDVNSENYK	37_4
50	522.93	1043.85	1043.55	43	ALEAAEELAK	biorepCdiffA_4
231	638.52	1275.02	1274.65	44	HYGLTTEDIVK	biorepCdiff_4
189	609.97	1217.92	1217.64	35	NSVAYPNLNVK	37_4
368	897.10	1792.19	1791.95	28	QAILASIDYNGPVYIR	37A_4

Matching Genes:

gi|115251376|emb|CAJ69208.1| (transketolase [Clostridium difficile 630])

Protein Group 98

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
205	8	4	3	19

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
292	903.77	1805.53	1804.98	34	ATIGQVGNIEHGNVVIGK	biorepCdiffA_4
146	531.98	1061.95	1061.55	51	SAGVSAQLMAK	biorepCdiff_4
252	825.13	1648.24	1647.86	70	TANIALLNYADGEKR	biorepCdiffA_4
176	589.42	1176.82	1176.58	50	VATIEYDPNR	biorepCdiff_4

Matching Genes:

gi|115249080|emb|CAJ66891.1| (50S ribosomal protein L2 [Clostridium difficile 630])

Protein Group 99

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
193	10	4	2	31

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
179	583.37	1164.72	1164.60	47	EQALVEVSYK	37A_2
490	730.49	1458.96	1458.78	88	ILGGGLPYESAVQR	37_2
457	469.92	1406.73	1406.73	33	VKDALEMLSHHK	37_2
146	530.25	1058.48	1058.60	25	VKVETGIDAK	37A_2

Matching Genes:

gi|115249807|emb|CAJ67624.1| (putative NUDIX-family hydrolase [Clostridium difficile 630])

Protein Group 100

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
192	6	4	2	37

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
322	584.39	1750.16	1749.89	35	HQKPSAMNQQGGIINK	biorepCdiffA_1
577	589.68	1766.01	1765.89	43	HQKPSAMNQQGGIINK +Oxidation (M)	37_1
166	543.91	1085.81	1085.64	36	KGDTVVVIAGK	37A_1
190	585.99	1169.96	1169.70	78	VLVEGVNVITK	37A_1

Matching Genes:

gi|115249088|emb|CAJ66899.1| (50S ribosomal protein L24 [Clostridium difficile 630])

Protein Group 101

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
183	9	4	2	40

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
465	798.62	2392.85	2392.22	34	HKPTFTPHVDGGDFVVVVNAEK	biorepCdiffA_2
344	861.69	1721.37	1720.92	82	KPEEVISHAVSGMLPK	biorepCdiffA_3
190	604.87	1207.72	1207.62	27	KWYLVDAEGK	37A_2
229	543.98	1085.95	1085.64	40	LATEIATVLR	biorepCdiff_2

Matching Genes:

gi|115249112|emb|CAJ66923.1| (50S ribosomal protein L13 [Clostridium difficile 630])

Protein Group 102

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
181	6	4	3	24

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
413	845.12	1688.22	1687.71	47	ALDACEDKEDTMYK	biorepCdiff_4
199	619.55	1237.08	1236.59	48	FGVEEIEAESK	biorepCdiff_4
500	976.18	1950.34	1949.87	60	TDEKEVDDENVTDINSK	biorepCdiff_4
59	458.27	914.53	914.54	26	VVRPSMVK	37A_4

Matching Genes:

gi|115251516|emb|CAJ69349.1| (heat shock protein [Clostridium difficile 630])

Protein Group 103

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
180	7	4	3	12

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
334	726.00	1449.98	1449.75	47	GFFPEEELITLR	37_4
169	418.96	1253.86	1253.81	49	KVTGKPTVIIAK	37A_4
149	539.81	1077.61	1077.46	49	MNVCAENPK +Oxidation (M)	37_4
166	563.90	1125.78	1125.71	35	VTGKPTVIIAK	37_4

Matching Genes:

gi|115251377|emb|CAJ69209.1| (transketolase [Clostridium difficile 630])

Protein Group 104

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
179	9	3	3	17

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
321	775.45	1548.88	1548.81	82	ELSDIIGFTASQIR	37A_3
503	793.06	1584.10	1583.83	57	GVWNFAPLDLEVPK	37_3
151	482.86	963.70	963.50	40	YLGDLLDR	biorepCdiff_3

Matching Genes:

gi|115249180|emb|CAJ66992.1| (putative DNA-binding protein [Clostridium difficile 630])

Protein Group 105

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
174	8	3	2	29

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
337	738.12	1474.23	1473.79	85	IGVIGGGSITYPNAR	37A_1
114	572.40	1142.79	1142.52	52	LSETDEFFR	biorepCdiffA_1
138	478.30	954.59	954.47	37	TYSEGAISK	37A_1

Matching Genes:

gi|115251040|emb|CAJ68871.1| (putative decarboxylase [Clostridium difficile 630])

Protein Group 106

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
174	5	4	1	30

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
514	1094.33	2186.65	2186.10	36	ELDNLEEGVVVTIVDNETAK	37_6
355	822.59	1643.16	1642.86	73	GFIYTLTESKPYPK	37A_3
594	955.67	1909.32	1909.02	32	LQVGTVTNMYTIVETLK	37_3
187	517.47	1032.92	1032.49	33	MGLGNDELGK	biorepCdiff_3

Matching Genes:

gi|115252732|emb|CAJ70576.1| (conserved hypothetical protein [Clostridium difficile 630])

Protein Group 107

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
173	4	3	3	11

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
689	1029.57	3085.68	3085.44	60	EFYPDASEFYLSDGYDLVNALTGSTIAK	biorepCdiff_4
303	686.50	1370.99	1371.70	60	GEADTISAAPVSVR	37_4
123	591.81	1181.61	1181.59	53	LGSISDSVYNK	37A_4

Matching Genes:

gi|115251246|emb|CAJ69077.1| (cell surface protein [Clostridium difficile 630])

Protein Group 108

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
172	5	4	2	27

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
672	1065.99	2129.97	2129.14	34	AATVETGAVVQVPLFINTGDK	biorepCdiff_3
149	466.29	930.56	930.48	54	ENEVATIR	37_3
326	783.02	1564.02	1563.75	30	TGAIREESFNPSEK	37A_3
26	413.24	824.47	824.40	54	TGEYLSR	37_3

Matching Genes:

gi|115250279|emb|CAJ68101.1| (elongation factor P [Clostridium difficile 630])

Protein Group 109

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
168	6	3	2	27

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
340	858.26	1714.51	1713.88	69	APAFEGNNMVVIIDPK	biorepCdiffA_3
463	749.57	1497.12	1496.79	39	LRPGIEQNDLNTK	biorepCdiff_3
390	940.33	1878.64	1877.97	60	NLDLVQISPNANPPVCK	biorepCdiffA_3

Matching Genes:

gi|115249701|emb|CAJ67518.1| (translation initiation factor IF-3 [Clostridium difficile 630])

Protein Group 110

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
167	4	3	3	18

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
133	555.82	1109.62	1109.61	50	IAYLFEAVGK	37A_3
116	515.31	1028.61	1028.55	52	LLENLNEGK	37A_3
386	676.91	1351.80	1351.62	65	NLMAGFAGESEAR	37_3

Matching Genes:

gi|115249842|emb|CAJ67659.1| (rubrerythrin [Clostridium difficile 630])

Protein Group 111

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
166	4	3	2	6

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
203	731.47	1460.93	1460.76	59	DANANIVLNNLYK	37A_7
547	1158.86	2315.72	2315.23	28	IATLIPIDGNDENEYLLLATK	37_7
213	644.91	1287.81	1287.67	79	TNDEVNVVSIAK	37_7

Matching Genes:

gi|115249009|emb|CAJ66820.1| (DNA gyrase subunit A [Clostridium difficile 630])

Protein Group 112

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
166	6	2	2	15

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
429	706.95	1411.88	1411.68	83	QNFGQVSNSYIR	37_3
566	889.08	1776.14	1775.81	83	TGEGDGDDEQIVVDLSK	37_3

Matching Genes:

gi|115250675|emb|CAJ68499.1| (tellurium resistance protein [Clostridium difficile 630])

Protein Group 113

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
165	6	3	2	4

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
289	887.26	1772.51	1771.92	47	EDLPVLLPTDVEFTGK	37A_7
1	402.25	802.49	802.41	31	VALEDEK	37_7
324	771.95	1541.88	1541.66	87	YVDSNNENEPFSK	37_7

Matching Genes:

gi|115251575|emb|CAJ69408.1| (leucyl-tRNA synthetase [Clostridium difficile 630])

Protein Group 114

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
164	6	3	3	6

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
163	602.43	1202.84	1202.63	51	AAQLVEMLGAGK +Oxidation (M)	37_7
289	721.51	1441.00	1440.76	52	GVVDVYPNKPEPK	37_7
421	962.18	1922.34	1921.94	61	SLGLAGVMGGANSEITSNTK +Oxidation (M)	37_7

Matching Genes:

gi|115249716|emb|CAJ67533.1| (phenylalanyl-tRNA synthetase beta chain [Clostridium difficile 630])

Protein Group 115

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
164	6	3	2	7

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
83	462.33	922.64	922.49	30	FPYEIVR	37_6
248	694.43	1386.84	1386.70	76	KLEEGADVDLGNK	biorepCdiff_6
284	486.29	1455.84	1455.65	58	TESMHGAGSPQAQR	37_6

Matching Genes:

gi|115251396|emb|CAJ69228.1| (gamma-aminobutyrate metabolism dehydratase/isomerase [includes: 4-hydroxybutyryl-coa dehydratase; vinylacetyl-coa-delta-isomerase] [Clostridium difficile 630])

Protein Group 116

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
163	5	4	1	15

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
105	535.50	1068.99	1068.59	26	FTAEVYVLK	biorepCdiff_5
353	590.32	1767.94	1767.78	34	HYAHVDCPGHADYVK	biorepCdiffA_3
296	604.05	1809.14	1808.96	37	TKPHVNIGTIGHVDHGK	37A_5
417	1083.27	2164.52	2164.04	66	YQLGEAVDFANIDKAPEER	37_5

Matching Genes:

gi|115249061|emb|CAJ66872.1| (elongation factor TU [Clostridium difficile 630])

Other Genes Matching Peptide Subset:

gi|115249075|emb|CAJ66886.1| (elongation factor TU [Clostridium difficile 630])

Protein Group 117

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
163	8	3	3	42

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
382	1002.33	2002.64	2002.00	72	LEANAGDVVTLNEVLACSK	biorepCdiffA_1
183	671.61	1341.20	1340.73	50	LGSPVVEGASVQAK	biorepCdiffA_1
273	611.46	1220.91	1220.63	41	VSEGDVLFVEK	biorepCdiff_2

Matching Genes:

gi|115250193|emb|CAJ68014.1| (50S ribosomal protein L21 [Clostridium difficile 630])

Protein Group 118

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
160	4	3	2	16

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
497	1003.17	2004.33	2003.92	70	DVYACCTHGVLSGPAIER	37_4
119	579.26	1156.51	1156.54	33	MIFSNESVSK +Oxidation (M)	37A_4
611	796.05	2385.12	2384.26	57	NVILLDDMIDTAGTIVNAANALK	biorepCdiff_4

Matching Genes:

gi|115252575|emb|CAJ70418.1| (ribose-phosphate pyrophosphokinase [Clostridium difficile 630])

Protein Group 119

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
159	5	2	2	39

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
119	456.34	910.66	910.50	65	GPQAANVVR	37A_1
351	919.23	1836.44	1835.88	94	TLEEGQSVEFEVVDGAK	biorepCdiffA_1

Matching Genes:

gi|115250391|emb|CAJ68213.1| (putative cold shock protein [Clostridium difficile 630])

Protein Group 120

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
158	7	3	2	38

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
389	1024.75	2047.49	2046.82	46	DECDNSYIYTFYTNDK	biorepCdiffA_1
676	907.39	1812.76	1812.85	25	EEFEELKNNTYIER	biorepCdiff_1
393	863.67	1725.32	1724.79	87	IVDEYDYGYNAIYK	37A_1

Matching Genes:

gi|115249824|emb|CAJ67641.1| (hypothetical protein [Clostridium difficile 630])

Protein Group 121

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
157	6	3	2	26

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
281	580.29	1158.58	1158.62	51	KAGQICDLVR	37_1
103	543.50	1084.98	1084.61	69	NVDEALAILK	biorepCdiffA_1
285	506.38	1010.74	1010.58	37	TSHIEVVVK	biorepCdiff_1

Matching Genes:

gi|115249082|emb|CAJ66893.1| (50S ribosomal protein L22 [Clostridium difficile 630])

Protein Group 122

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
152	6	4	1	50

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
73	478.40	954.79	954.55	39	KYTFVVAK	biorepCdiffA_1
500	908.01	2721.00	2720.31	31	MTNPHDVIIRPVVTEHSMAEMGEK	biorepCdiffA_1
75	426.01	850.00	849.46	36	VFGVSVDK	biorepCdiff_1
241	512.24	1022.46	1022.50	46	VNTLNYDGK	37_1

Matching Genes:

gi|115249079|emb|CAJ66890.1| (50S ribosomal protein L23 [Clostridium difficile 630])

Protein Group 123

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
152	4	2	2	11

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
426	869.15	1736.28	1735.76	69	ADIDYGFAEADTTYGK	biorepCdiff_4
397	832.57	1663.13	1662.82	83	TEGYSEGNVPLQTLR	37_4

Matching Genes:

gi|115249083|emb|CAJ66894.1| (30S ribosomal protein S3 [Clostridium difficile 630])

Protein Group 124

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
152	6	3	2	22

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
369	670.54	1339.06	1338.71	31	LYRPANTFVMK	biorepCdiff_2
309	834.06	1666.12	1665.77	57	MLSEMAIQDPEGFAK	biorepCdiffA_2
318	842.12	1682.24	1681.77	64	MLSEMAIQDPEGFAK +Oxidation (M)	biorepCdiffA_2

Matching Genes:

gi|115249703|emb|CAJ67520.1| (50S ribosomal protein L20 [Clostridium difficile 630])

Protein Group 125

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
152	7	3	1	20

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
84	507.92	1013.82	1013.49	30	FWEEYLK	biorepCdiffA_3
344	534.00	1598.97	1598.72	31	NLSDNHESQEAEVK	37A_3
448	739.10	1476.19	1475.76	91	VEAGIYNEILNNK	biorepCdiff_3

Matching Genes:

gi|115252635|emb|CAJ70478.1| (putative preprotein translocase [Clostridium difficile 630])

Protein Group 126

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
150	7	3	3	6

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
256	699.02	1396.02	1395.74	49	AGEDQQPIILANK	37_6
330	777.01	1552.01	1551.69	54	HNAPTEPDNSGSAAGK	37_7
330	800.57	1599.13	1598.76	47	TYVSAYHSTNLSEK	biorepCdiff_6

Matching Genes:

gi|115251837|emb|CAJ69672.1| (cell surface protein [Clostridium difficile 630])

Protein Group 127

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
149	4	4	1	6

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
407	625.84	1874.51	1873.98	29	DGSLVGAILINDLSCTVK	biorepCdiff_7
295	916.04	1830.07	1829.79	28	TLVTCDSFGSHYSNDK	37A_7
140	607.46	1212.90	1212.65	34	VNLFDVIEHK	biorepCdiff_7
50	459.37	916.72	916.52	58	VVASETAIK	37A_7

Matching Genes:

gi|115250664|emb|CAJ68488.1| (putative nitric oxide reductase flavoprotein [Clostridium difficile 630])

Protein Group 128

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
149	4	3	1	12

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
263	727.52	1453.02	1452.71	88	ALLDAVNTGDYSSK	37A_4
229	630.38	1258.75	1258.57	36	HMPFVEENEK	37_4
177	685.97	1369.92	1370.65	25	RISYMSEVDQK +Oxidation (M)	37A_7

Matching Genes:

gi|115252096|emb|CAJ69934.1| (proline iminopeptidase [Clostridium difficile 630])

Protein Group 129

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
147	7	3	2	9

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
139	520.35	1038.69	1038.62	32	AEAIVKPGVR	37_4
64	517.89	1033.76	1033.53	40	ATVSGELTEK	biorepCdiffA_5
174	680.98	1359.95	1359.78	75	FLLNLIELGGGSK	37A_5

Matching Genes:

gi|115251664|emb|CAJ69499.1| (probable peptidase [Clostridium difficile 630])

Protein Group 130

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
141	9	3	2	27

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
215	518.44	1034.86	1034.54	34	GITEVVFDR	biorepCdiff_2
143	493.80	985.58	985.52	47	IQELAEGAR	37A_1
570	574.82	1721.42	1720.87	60	SANNIYAQIIDDTKR	biorepCdiff_2

Matching Genes:

gi|115249093|emb|CAJ66904.1| (50S ribosomal protein L18 [Clostridium difficile 630])

Protein Group 131

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
136	6	3	1	44

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
120	590.43	1178.84	1178.55	37	DLTSEELMNK	biorepCdiffA_1
231	724.99	1447.96	1447.74	67	FQLATGQLENTAR	biorepCdiffA_1
26	426.41	850.80	850.45	32	SELFSLR	biorepCdiffA_1

Matching Genes:

gi|115249085|emb|CAJ66896.1| (50S ribosomal protein L29 [Clostridium difficile 630])

Protein Group 132

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
135	3	2	2	6

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
298	909.14	1816.26	1815.97	84	ILVINNPSNPTGSVYTK	37A_5
57	453.03	904.04	903.51	51	YDLVPGLK	biorepCdiff_5

Matching Genes:

gi|115249115|emb|CAJ66926.1| (aspartate aminotransferase [Clostridium difficile 630])

Protein Group 133

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
135	7	3	2	26

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
188	479.73	957.44	957.51	38	AIEQEQLK	37_2
242	566.42	1130.83	1130.67	50	IQVFEGVVLK	biorepCdiff_2
402	687.44	1372.86	1372.66	47	NEVPNFGPGDTVK	biorepCdiff_2

Matching Genes:

gi|115250291|emb|CAJ68113.1| (50S ribosomal protein L19 [Clostridium difficile 630])

Protein Group 134

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
135	10	2	1	21

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
361	935.32	1868.62	1868.91	102	LAGEGGLFFVDQEFANR	biorepCdiffA_1
590	669.07	2004.20	2004.03	33	VTALINNLAAVANSESDFR	37_2

Matching Genes:

gi|115251248|emb|CAJ69079.1| (ferritin [Clostridium difficile 630])

Protein Group 135

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
135	3	2	2	9

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
374	869.15	1736.28	1735.90	79	VTTAFNDTTIADGIAVK	37_6
427	1103.74	2205.47	2205.04	56	YSFSTIMEDKPGNFAELTR	37_5

Matching Genes:

gi|115251567|emb|CAJ69400.1| (threonine dehydratase catabolic [Clostridium difficile 630])

Protein Group 136

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
135	7	2	2	12

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
304	748.00	1493.99	1493.85	63	AGVVLNPATPVDTIK	37A_3
186	616.90	1231.79	1231.68	72	LAPSILSADFAK	37A_3

Matching Genes:

gi|115251631|emb|CAJ69464.1| (ribulose-phosphate 3-epimerase [Clostridium difficile 630])

Protein Group 137

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
130	3	2	2	20

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
508	881.67	2641.98	2641.24	61	LPGEVESYEYGLEYGTDTLEIHK	37A_3
325	633.39	1264.77	1264.67	69	LSNYDVNSLIK	37_2

Matching Genes:

gi|115251797|emb|CAJ69632.1| (adenine phosphoribosyltransferase [Clostridium difficile 630])

Protein Group 138

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
124	3	3	1	26

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
809	1179.86	3536.55	3535.76	39	LVMNLGFSHPVEMEDPEGITVEAPNQTELIVK	biorepCdiff_3
85	508.38	1014.74	1014.57	50	QLSAELNIK	biorepCdiffA_3
40	447.38	892.74	892.47	35	YVDEVIR	biorepCdiffA_3

Matching Genes:

gi|115249092|emb|CAJ66903.1| (50S ribosomal protein L6 [Clostridium difficile 630])

Protein Group 139

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
124	3	2	2	12

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
483	778.56	1555.11	1554.83	74	DVIDAVSISLNAPNK	37_3
197	508.34	1014.67	1013.58	50	INELIDVAK	37_3

Matching Genes:

gi|115249398|emb|CAJ67213.1| (Radical SAM-superfamily protein [Clostridium difficile 630])

Protein Group 140

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
124	4	2	2	15

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
258	584.87	1167.73	1167.58	56	ESVDFPIYAK	37_2
219	624.36	1246.71	1246.60	68	GIEVEDVGTNSK	37A_2

Matching Genes:

gi|115251375|emb|CAJ69207.1| (ribose-5-phosphate isomerase 1 [Clostridium difficile 630])

Protein Group 141

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
120	4	3	1	4

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
45	497.84	993.67	994.47	34	ENMLWFR	biorepCdiffA_7
559	1195.37	2388.72	2388.17	56	LAPSLTLGCGSWGGNSVSENVGVK	37_7
99	511.54	1021.07	1020.57	30	LSPVLAMYK	biorepCdiff_7

Matching Genes:

gi|115249343|emb|CAJ67156.1| (aldehyde-alcohol dehydrogenase [includes: alcohol dehydrogenase; acetaldehyde dehydrogenase [acetylating]; pyruvate-formate-lyase deactivase [Clostridium difficile 630])

Protein Group 142

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
120	3	2	2	10

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
351	436.97	1307.89	1307.69	50	KENIAIQEAHR	37_3
329	696.69	1391.37	1390.68	70	MEEEGVFNVLPK	biorepCdiff_4

Matching Genes:

gi|115251194|emb|CAJ69025.1| (30S ribosomal protein S2 [Clostridium difficile 630])

Protein Group 143

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
119	6	3	2	20

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
495	491.57	1471.69	1470.80	45	IYSSLYLEDLKK	37_2
5	409.77	817.53	817.42	48	LSDGLGEK	37A_2
159	648.45	1294.89	1294.63	26	YLIDITEEGDK	biorepCdiffA_2

Matching Genes:

gi|115250371|emb|CAJ68193.1| (MarR-family transcriptional regulator [Clostridium difficile 630])

Protein Group 144

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
114	3	2	2	10

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
251	580.92	1159.82	1159.67	48	MIIFPAIDIK	37_3
535	844.05	1686.08	1685.83	66	VNVYYDNPLEVAYK	37_3

Matching Genes:

gi|115250593|emb|CAJ68417.1| (putative 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylidene amino] imidazole-4-carboxamide isomerase [Clostridium difficile 630])

Protein Group 145

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
114	4	3	1	12

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
76	459.79	917.57	917.48	37	GENIGTTVK	37A_3
205	632.35	1262.68	1262.61	46	NVDAVYDKDPK	37A_3
164	475.30	948.59	948.47	31	VQTAIDMR +Oxidation (M)	37_3

Matching Genes:

gi|115251192|emb|CAJ69023.1| (uridylate kinase [Clostridium difficile 630])

Protein Group 146

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
112	3	2	2	36

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
784	784.73	2351.17	2350.11	45	EAEAALNAFMSSVQDALVNNEK	biorepCdiff_1
444	677.39	1352.77	1352.71	67	VQLVGFGTFETR	37_1

Matching Genes:

gi|115252557|emb|CAJ70400.1| (DNA-binding protein HU [Clostridium difficile 630])

Protein Group 147

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
111	2	2	1	12

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
551	915.24	2742.70	2742.33	74	GIMTVEDALMAVEAGVDAIVVSNHGGR +2 Oxidation (M)	37A_4
288	779.93	1557.85	1557.75	37	VLDCTPGACEVLPK	37A_4

Matching Genes:

gi|115250297|emb|CAJ68119.1| (putative FMN-dependent dehydrogenase [Clostridium difficile 630])

Protein Group 148

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
110	3	2	1	21

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
425	711.51	2131.50	2131.16	81	IAQMIVKPIYDINIEEVK +Oxidation (M)	37A_2
320	489.97	1466.89	1466.75	29	LNDDAIIPNFAHK	37A_2

Matching Genes:

gi|115251455|emb|CAJ69288.1| (deoxyuridine 5'-triphosphate nucleotidohydrolase [Clostridium difficile 630])

Protein Group 149

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
109	3	2	2	10

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
202	687.98	1373.95	1373.76	61	ALQATGLEVTMIK	biorepCdiffA_2
427	696.06	1390.11	1389.75	48	ALQATGLEVTMIK +Oxidation (M)	biorepCdiff_2

Matching Genes:

gi|115249104|emb|CAJ66915.1| (30S ribosomal protein S11 [Clostridium difficile 630])

Protein Group 150

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
107	2	2	1	10

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
411	854.55	1707.09	1705.90	38	AAINSLTQNIATQYAK	37_4
233	634.39	1266.77	1267.64	69	SEELAHEVINK	37_4

Matching Genes:

gi|115249069|emb|CAJ66880.1| (NADP-dependent 7-alpha-hydroxysteroid dehydrogenase [Clostridium difficile 630])

Protein Group 151

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
107	2	2	2	8

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
214	628.04	1254.07	1253.75	46	LPIILYNVPGR	biorepCdiff_4
366	761.21	1520.41	1519.78	61	TAMNILGFNVGDLR	biorepCdiff_4

Matching Genes:

gi|115252280|emb|CAJ70121.1| (dihydrodipicolinate synthase [Clostridium difficile 630])

Protein Group 152

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
102	4	3	1	6

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
478	1042.75	2083.49	2082.92	40	GTYGDTYGIHGNNNESSIGK	biorepCdiff_7
241	700.53	1399.05	1399.73	33	IAEELGNREEIK	biorepCdiff_7
60	537.38	1072.75	1072.57	29	INLNQTGWK	biorepCdiffA_7

Matching Genes:

gi|115251764|emb|CAJ69599.1| (cell surface protein [Clostridium difficile 630])

Protein Group 153

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
102	5	2	1	32

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
735	1027.39	2052.77	2052.02	38	NYELVYVVKPNSDEEVR	biorepCdiff_1
198	694.02	1386.03	1385.78	64	VKEVVATDGEIVK	biorepCdiffA_1

Matching Genes:

gi|115252728|emb|CAJ70572.1| (30S ribosomal protein S6 [Clostridium difficile 630])

Protein Group 154

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
101	6	3	0	24

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
20	410.25	818.48	818.45	39	IETTVTR	37A_1
538	697.60	1393.20	1392.70	31	KGDAAEMAFIELV	biorepCdiff_1
275	494.94	987.87	987.55	31	NLVTCLLR	biorepCdiff_1

Matching Genes:

gi|115249107|emb|CAJ66918.1| (50S ribosomal protein L17 [Clostridium difficile 630])

Protein Group 155

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
99	2	2	2	8

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
339	663.01	1324.00	1323.64	55	VMFELAGVSEDK	biorepCdiff_3
268	670.87	1339.72	1339.63	44	VMFELAGVSEDK +Oxidation (M)	37A_2

Matching Genes:

gi|115249084|emb|CAJ66895.1| (50S ribosomal protein L16 [Clostridium difficile 630])

Protein Group 156

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
97	3	3	0	26

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
288	813.19	1624.36	1623.81	31	HVPVYITEDMVGHK	biorepCdiffA_1
291	821.10	1640.19	1639.80	34	HVPVYITEDMVGHK +Oxidation (M)	biorepCdiffA_1
282	581.82	1161.63	1161.58	32	KIEAMNASGNK	37_1

Matching Genes:

gi|115249081|emb|CAJ66892.1| (30S ribosomal protein S19 [Clostridium difficile 630])

Protein Group 157

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
97	3	3	0	17

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
261	687.98	1373.94	1373.69	34	FIVGYGIDYAEK	37A_3
122	582.48	1162.95	1162.63	27	GASVFVSDLIR	biorepCdiffA_3
210	504.25	1006.49	1006.50	36	MLTEEQIK +Oxidation (M)	37_2

Matching Genes:

gi|115251742|emb|CAJ69577.1| (putative phosphoribosyltransferase [Clostridium difficile 630])

Protein Group 158

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
97	2	2	1	8

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
48	434.97	867.93	867.52	38	IEPGAIIR	biorepCdiff_4
256	712.92	1423.82	1423.68	59	MVNLNDAYEIAR +Oxidation (M)	37A_4

Matching Genes:

gi|115252284|emb|CAJ70125.1| (2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase [Clostridium difficile 630])

Protein Group 159

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
96	2	2	1	12

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
259	588.36	1174.71	1174.66	59	TPEQLSIFLK	37_2
156	551.34	1100.66	1100.58	37	VLEDDKNLR	37A_2

Matching Genes:

gi|115249226|emb|CAJ67039.1| (phosphoribosylaminoimidazole carboxylase catalytic subunit [Clostridium difficile 630])

Protein Group 160

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
96	3	1	1	9

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
478	715.91	1429.81	1429.74	96	VTVDENTIGQINK	37_2

Matching Genes:

gi|115251795|emb|CAJ69630.1| (putative D-tyrosyl-tRNA protein [Clostridium difficile 630])

Protein Group 161

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
96	2	2	1	13

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
536	1078.23	2154.46	2153.99	68	CIWGEGDGSTLTVVDTPYGK	37_4
618	1211.39	2420.77	2420.07	28	ELDAEPEIMCPGGSCIVDPFGK	biorepCdiff_4

Matching Genes:

gi|115251895|emb|CAJ69730.1| (nitrilase (carbon-nitrogen hydrolase) [Clostridium difficile 630])

Protein Group 162

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
93	3	2	1	22

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
139	651.97	1301.93	1301.68	32	EVEASVGGGAVTVK	biorepCdiff_8
186	675.39	1348.77	1348.63	61	NIDDIQASQMSK	biorepCdiffA_1

Matching Genes:

gi|115249020|emb|CAJ66831.1| (conserved hypothetical protein [Clostridium difficile 630])

Protein Group 163

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
91	2	1	1	22

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
511	745.43	1488.85	1488.71	91	EAEEGCPVSAITVK	37_1

Matching Genes:

gi|115252670|emb|CAJ70513.1| (ferredoxin [Clostridium difficile 630])

Protein Group 164

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
87	2	2	1	13

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
66	484.89	967.76	967.57	39	ILLDEPIR	biorepCdiffA_3
220	566.65	1131.29	1131.60	48	MAVQADSVAIK	biorepCdiff_3

Matching Genes:

gi|115252722|emb|CAJ70566.1| (50S ribosomal protein L9 [Clostridium difficile 630])

Protein Group 165

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
85	3	2	1	25

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
237	628.98	1255.94	1255.71	59	IIQLDSNVINK	37A_1
93	440.30	878.59	878.42	26	VSFNQER	37A_1

Matching Genes:

gi|115249124|emb|CAJ66935.1| (ferredoxin [Clostridium difficile 630])

Protein Group 166

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
83	3	2	1	25

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
622	698.03	2091.08	2090.83	30	LVEFPSDHTCSHDGCGHH	37_1
328	479.62	1435.85	1435.63	53	SLDNGDLDHEHGK	37A_1

Matching Genes:

gi|115250736|emb|CAJ68560.1| (putative dinitrogenase iron-molybdenum cofactor [Clostridium difficile 630])

Protein Group 167

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
81	1	1	1	5

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
391	930.05	1858.09	1857.88	81	TIDEDESGALNPELVEK	37A_4

Matching Genes:

gi|115251648|emb|CAJ69481.1| (low-specificity L-threonine aldolase [Clostridium difficile 630])

Protein Group 168

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
81	2	2	2	4

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
335	807.63	1613.24	1612.76	40	FFNEEEMNAILTR	biorepCdiff_6
142	593.72	1185.42	1184.64	41	VGQEGVTSPIAK	biorepCdiff_6

Matching Genes:

gi|115251791|emb|CAJ69626.1| (putative aspartyl-tRNA synthetase [Clostridium difficile 630])

Protein Group 169

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
79	2	2	1	11

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
43	417.77	833.52	833.46	33	LSVSATTR	37_3
332	788.51	1575.00	1574.76	46	TGEVDGVNYFFISK	37A_3

Matching Genes:

gi|115251645|emb|CAJ69478.1| (guanylate kinase [Clostridium difficile 630])

Protein Group 170

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
78	3	1	1	4

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
180	693.01	1384.01	1383.80	78	ILITGSPIGGISEK	37A_5

Matching Genes:

gi|115250793|emb|CAJ68617.1| (putative 2-hydroxyacyl-CoA dehydratase [Clostridium difficile 630])

Protein Group 171

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
78	2	2	1	7

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
320	778.02	1554.03	1553.78	32	GIPVSIGTDGAPSNNR	37_6
343	817.54	1633.06	1632.75	46	SVMDTGDGLPEAWQK	37_6

Matching Genes:

gi|115251756|emb|CAJ69591.1| (putative amidohydrolas [Clostridium difficile 630])

Protein Group 172

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
77	2	2	1	4

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
90	592.94	1183.86	1183.61	29	LDIYQEYIK	biorepCdiffA_6
159	687.55	1373.08	1372.72	48	NLSKEEVEANIK	biorepCdiffA_6

Matching Genes:

gi|115249054|emb|CAJ66865.1| (glutamyl-tRNA synthetase [Clostridium difficile 630])

Protein Group 173

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
75	2	2	1	5

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
66	494.80	987.58	987.46	41	QEDLEAGAR	37A_6
288	742.02	1482.02	1481.70	34	SHEEGISPEEVAAK	biorepCdiff_6

Matching Genes:

gi|115249055|emb|CAJ66866.1| (cysteinyl-tRNA synthetase [Clostridium difficile 630])

Protein Group 174

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
75	1	1	1	8

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
439	716.51	1431.00	1430.76	75	VTSTGIVNGVIEDK	37_3

Matching Genes:

gi|115252223|emb|CAJ70063.1| (putative phosphatidylethanolamine-binding regulatory protein [Clostridium difficile 630])

Protein Group 175

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
73	2	1	1	4

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
287	778.95	1555.89	1555.76	73	SIQAIDSHTAGEATR	37A_4

Matching Genes:

gi|115252294|emb|CAJ70135.1| (putative proline racemase [Clostridium difficile 630])

Protein Group 176

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
73	3	2	1	29

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
347	914.46	1826.90	1826.94	41	AEGDTGSPEVQIALLTAR	biorepCdiffA_1
17	417.93	833.84	833.50	32	NLLAYLK	biorepCdiffA_1

Matching Genes:

gi|115250352|emb|CAJ68174.1| (30S ribosomal protein S15 [Clostridium difficile 630])

Protein Group 177

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
72	1	1	1	4

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
139	611.34	1220.67	1220.64	72	AYGANLVLTDGK	37A_4

Matching Genes:

gi|115250635|emb|CAJ68459.1| (putative O-acetylserine sulfhydrylase [Clostridium difficile 630])

Protein Group 178

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
72	2	2	1	4

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
209	664.39	1326.76	1326.58	27	ATEEFNCTIDK	biorepCdiff_6
154	652.36	1302.71	1302.60	45	SATHDQNFLDR	37A_6

Matching Genes:

gi|115251601|emb|CAJ69434.1| (conserved hypothetical protein [Clostridium difficile 630])

Protein Group 179

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
70	2	1	1	9

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
351	881.72	1761.43	1760.81	70	TGVGDGDDEQINVDLSK	biorepCdiffA_3

Matching Genes:

gi|115250845|emb|CAJ68669.1| (tellurium resistance protein [Clostridium difficile 630])

Protein Group 180

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
69	1	1	1	4

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
165	622.90	1243.79	1243.68	69	TGAASGAAIDVLAK	37A_4

Matching Genes:

gi|115249560|emb|CAJ67377.1| (putative ornithine cyclodeaminase [Clostridium difficile 630])

Protein Group 181

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
68	1	1	1	18

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
630	688.96	2063.86	2063.24	68	IATAGVVLGAVTGAVSGVLLAPK	biorepCdiff_2

Matching Genes:

gi|115250942|emb|CAJ68770.1| (putative membrane protein [Clostridium difficile 630])

Protein Group 182

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
66	2	2	0	8

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
171	576.31	1150.61	1150.57	33	IASFSQQSQR	37_4
117	576.33	1150.64	1149.60	33	LISHTPEPEK	37A_4

Matching Genes:

gi|115249057|emb|CAJ66868.1| (putative thymidylate synthase [Clostridium difficile 630])

Protein Group 183

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
66	2	1	1	5

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
191	503.79	1005.56	1005.51	66	VPGATYAEAK	37_3

Matching Genes:

gi|115251487|emb|CAJ69320.1| (conserved hypothetical protein [Clostridium difficile 630])

Protein Group 184

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
65	2	2	0	12

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
36	429.28	856.54	856.50	33	AALLAPSSK	37A_3
275	503.75	1508.23	1507.76	32	TWEFIVVDDKEK	biorepCdiffA_3

Matching Genes:

gi|115249854|emb|CAJ67671.1| (putative reductase [Clostridium difficile 630])

Protein Group 185

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
65	1	1	1	2

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
237	672.44	1342.86	1342.67	65	VVNINANEVDEK	37_6

Matching Genes:

gi|115251568|emb|CAJ69401.1| (L-aspartate-beta-decarboxylase [Clostridium difficile 630])

Protein Group 186

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
63	3	2	0	8

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
288	603.28	1204.54	1204.54	33	DGHTNLYEEK	37_1
282	791.57	1581.13	1580.79	30	NTDIKEEYLSEIK	biorepCdiffA_2

Matching Genes:

gi|115250155|emb|CAJ67976.1| (nitroreductase-family protein [Clostridium difficile 630])

Protein Group 187

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
63	1	1	1	9

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
487	781.07	1560.12	1559.86	63	FINGILGSVVDEIGK	37_3

Matching Genes:

gi|115250234|emb|CAJ68055.1| (N utilization substance protein B [Clostridium difficile 630])

Protein Group 188

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
63	1	1	1	2

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
183	749.05	1496.09	1495.69	63	VYGEGADSQGVSATR	biorepCdiffA_7

Matching Genes:

gi|115251074|emb|CAJ68905.1| (chaperone [Clostridium difficile 630])

Protein Group 189

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
62	1	1	1	15

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
304	838.83	1675.64	1675.83	62	VETQGATGIDNELTTK	biorepCdiffA_1

Matching Genes:

gi|115252071|emb|CAJ69908.1| (PTS system, IIb component [Clostridium difficile 630])

Protein Group 190

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
61	2	1	1	12

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
318	861.73	1721.45	1720.82	61	GYDVSSISTPDLENPK	biorepCdiffA_1

Matching Genes:

gi|115249013|emb|CAJ66824.1| (anti-sigma-B factor (serine-protein kinase) [Clostridium difficile 630])

Protein Group 191

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
61	2	1	1	12

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
348	636.36	1270.71	1270.69	61	QNINIVDISQK	37_1

Matching Genes:

gi|115251678|emb|CAJ69513.1| (conserved hypothetical protein [Clostridium difficile 630])

Protein Group 192

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
60	1	1	1	4

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
562	868.58	1735.16	1734.89	60	VITGLATSDDDSSITIK	37_2

Matching Genes:

gi|115251108|emb|CAJ68939.1| (aspartokinase [Clostridium difficile 630])

Protein Group 193

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
58	2	1	1	6

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
309	815.52	1629.03	1628.88	58	FGDGGVDILPIANLTK	37A_4

Matching Genes:

gi|115249811|emb|CAJ67628.1| (NH3-dependent NAD(+) synthetase [Clostridium difficile 630])

Protein Group 194

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
58	1	1	1	10

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
412	693.95	1385.88	1385.70	58	ELVPNTTDAAVEK	37_3

Matching Genes:

gi|115249844|emb|CAJ67661.1| (rubredoxin oxidoreductase (desulfoferrodoxin) [Clostridium difficile 630])

Protein Group 195

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
58	1	1	1	4

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
611	1182.90	2363.78	2364.29	58	EILGDIPISLSNEIGNIGILER	biorepCdiff_6

Matching Genes:

gi|115250762|emb|CAJ68586.1| (putative hydantoinase [Clostridium difficile 630])

Protein Group 196

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
58	2	1	1	3

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
195	644.44	1286.87	1286.63	58	ADAYGHGAVEVAK	biorepCdiff_5

Matching Genes:

gi|115252523|emb|CAJ70366.1| (alanine racemase [Clostridium difficile 630])

Protein Group 197

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
58	1	1	1	7

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
363	652.35	1302.68	1302.59	58	SAEFCANYITK	37_2

Matching Genes:

gi|115252727|emb|CAJ70571.1| (single-strand binding protein [Clostridium difficile 630])

Protein Group 198

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
57	2	1	1	6

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
384	1041.20	2080.38	2080.03	57	TLEKPGTNVSGTSDFVSVDK	37_5

Matching Genes:

gi|115249887|emb|CAJ67706.1| (ABC transporter, substrate-binding lipoprotein [Clostridium difficile 630])

Protein Group 199

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
57	3	1	1	16

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
671	900.41	1798.80	1797.88	57	FIEEIGYYNPISEPK	biorepCdiff_1

Matching Genes:

gi|115250287|emb|CAJ68109.1| (30S ribosomal protein S16 [Clostridium difficile 630])

Protein Group 200

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
57	1	1	1	9

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
347	801.55	1601.08	1600.82	57	LMVVNDAVANNSVQK	37A_2

Matching Genes:

gi|115252122|emb|CAJ69960.1| (PTS system, IIb component [Clostridium difficile 630])

Protein Group 201

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
56	1	1	1	13

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
145	631.68	1261.34	1260.71	56	TIVVAVEEFVR	biorepCdiffA_1

Matching Genes:

gi|115249086|emb|CAJ66897.1| (30S ribosomal protein S17 [Clostridium difficile 630])

Protein Group 202

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
56	1	1	1	7

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
527	862.88	2585.61	2585.31	56	NLIQPEDFSIEEIDEILELAQK	37A_4

Matching Genes:

gi|115249194|emb|CAJ67006.1| (aspartate carbamoyltransferase catalytic chain [Clostridium difficile 630])

Protein Group 203

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
56	1	1	1	0

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
256	773.51	1545.01	1544.67	56	NIAYNYTDESNNK	biorepCdiff_8

Matching Genes:

gi|115249677|emb|CAJ67494.1| (toxin A [Clostridium difficile 630])

Protein Group 204

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
56	1	1	1	6

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
176	683.55	1365.09	1364.70	56	IEELQFNPFTK	biorepCdiffA_4

Matching Genes:

gi|115251448|emb|CAJ69281.1| (conserved hypothetical protein [Clostridium difficile 630])

Protein Group 205

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
56	1	1	1	5

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
404	952.58	1903.15	1902.89	56	SLGPEPWQVCYVEPSR	37A_4

Matching Genes:

gi|115251486|emb|CAJ69319.1| (glycyl-tRNA synthetase alpha chain [Clostridium difficile 630])

Protein Group 206

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
55	1	1	1	4

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
306	621.88	1241.75	1241.64	55	VDLPLWQESR	37_3

Matching Genes:

gi|115250457|emb|CAJ68280.1| (putative ATP-binding protein [Clostridium difficile 630])

Protein Group 207

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
54	1	1	1	7

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
385	870.05	1738.08	1737.95	54	IIIENLTNLENVPEK	37A_3

Matching Genes:

gi|115251016|emb|CAJ68845.1| (putative cyclase [Clostridium difficile 630])

Protein Group 208

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
54	2	1	1	4

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
353	504.32	1509.93	1509.83	54	ISSKPIIATHSNSR	37_4

Matching Genes:

gi|115252633|emb|CAJ70476.1| (probable dipeptidase [Clostridium difficile 630])

Protein Group 209

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
54	1	1	1	22

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
147	636.60	1271.18	1270.70	54	LIDEALEDLIK	biorepCdiffA_1

Matching Genes:

gi|110666931|ref|YP_659585.1| (hypothetical protein CDP09 [Clostridium difficile 630])

Protein Group 210

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
53	1	1	1	2

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
123	533.38	1064.74	1064.55	53	IGGAEQIYSK	37_6

Matching Genes:

gi|115251373|emb|CAJ69205.1| (putative phosphoglucomutase [Clostridium difficile 630])

Protein Group 211

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
53	3	1	1	5

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
215	638.38	1274.75	1274.60	53	NQDVSDEDILK	37A_3

Matching Genes:

gi|115251628|emb|CAJ69461.1| (putative nitroreductase [Clostridium difficile 630])

Protein Group 212

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
52	1	1	1	6

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
242	551.30	1100.58	1100.61	52	EDIQVIGISK	37_2

Matching Genes:

gi|115250867|emb|CAJ68692.1| (putative thiol peroxidase (bacterioferritin comigratory protein) [Clostridium difficile 630])

Protein Group 213

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
50	1	1	1	6

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
149	574.88	1147.75	1147.61	50	GLTSVATDSLGK	37A_3

Matching Genes:

gi|115250535|emb|CAJ68359.1| (putative transcriptional regulator [Clostridium difficile 630])

Protein Group 214

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
48	2	1	1	11

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
449	700.70	2099.09	2098.09	48	GVTGFVGPGSKPVPLSEDEVK	37A_3

Matching Genes:

gi|115249064|emb|CAJ66875.1| (transcription antitermination protein [Clostridium difficile 630])

Protein Group 215

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
48	2	1	1	3

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
162	438.67	1312.98	1312.62	48	IGHMGENANLNK +Oxidation (M)	37_5

Matching Genes:

gi|115251586|emb|CAJ69419.1| (putative aminotransferase [Clostridium difficile 630])

Protein Group 216

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
48	1	1	1	10

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
419	635.57	1269.13	1268.60	48	IGIDEDHSVER	biorepCdiff_1

Matching Genes:

gi|115252725|emb|CAJ70569.1| (conserved hypothetical protein [Clostridium difficile 630])

Protein Group 217

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
47	2	1	1	6

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
39	497.77	993.53	993.55	47	YPFLLVDK	biorepCdiffA_8

Matching Genes:

gi|115249137|emb|CAJ66948.1| ((3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Clostridium difficile 630])

Protein Group 218

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
47	1	1	1	4

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
79	520.39	1038.77	1038.64	47	VTALINAIPK	37A_7

Matching Genes:

gi|115252333|emb|CAJ70174.1| (PTS system, IIc component [Clostridium difficile 630])

Protein Group 219

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
46	1	1	1	5

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
280	756.44	1510.87	1510.81	46	VVEPDILIEEVEK	37A_4

Matching Genes:

gi|115250078|emb|CAJ67898.1| (3-hydroxybutyryl-CoA dehydratase [Clostridium difficile 630])

Protein Group 220

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
46	1	1	1	4

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
165	600.33	1198.65	1199.55	46	FLGEEYNNSK	37A_3

Matching Genes:

gi|115252486|emb|CAJ70329.1| (precorrin-4 C(11)-methyltransferase [Clostridium difficile 630])

Protein Group 221

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
46	1	1	1	4

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
187	617.33	1232.65	1232.63	46	GIGYAFQQPPR	37A_3

Matching Genes:

gi|115252673|emb|CAJ70516.1| (ABC transporter, ATP-binding protein [Clostridium difficile 630])

Protein Group 222

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
45	4	1	1	1

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
177	450.33	1347.98	1347.77	45	GRPVTGPGNRPLK	37A_8

Matching Genes:

gi|115249071|emb|CAJ66882.1| (DNA-directed RNA polymerase beta' chain [Clostridium difficile 630])

Protein Group 223

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
45	2	1	1	7

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
107	552.04	1102.06	1101.57	45	IPTWIDTEK	biorepCdiffA_1

Matching Genes:

gi|115250980|emb|CAJ68809.1| (conserved hypothetical protein [Clostridium difficile 630])

Protein Group 224

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
43	1	1	1	3

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
377	872.82	1743.62	1742.87	43	IFPTGVEDVPNEEGLK	37_6

Matching Genes:

gi|115252150|emb|CAJ69988.1| (6-phospho-beta-glucosidase [Clostridium difficile 630])