Complete output

Complete outputComplete output

Protein Group 1

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
1305	74	29	16	30

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
484	1051.45	2100.88	2100.04	56	ALASQALSIFGDHQDVMAAR	biorepCdiff_7
264	595.14	1782.40	1781.83	27	ATYLIDEADYIACHK	biorepCdiffA_7
36	481.35	960.69	960.54	28	DFILAQVR	biorepCdiffA_8
43	528.85	1055.68	1056.54	32	ENAPMIIGGR	biorepCdiffA_8
252	767.07	1532.12	1531.75	44	EPGSTGEPLYLDVR	biorepCdiff_8
65	471.38	940.74	940.50	31	FYTVNAVK	biorepCdiff_7
187	756.04	1510.06	1509.72	42	GTAQNPDIYFQTR	biorepCdiffA_7
202	702.00	1401.99	1401.67	42	HFLDAMPSTVER	biorepCdiff_8
160	505.91	1514.72	1514.67	46	HSLFDYYGAEDAK	biorepCdiffA_8
431	1168.81	2335.61	2335.01	52	IQVSPLDCTGCGNCADICPAK	biorepCdiffA_7
347	938.77	1875.53	1874.99	97	IVNMNYAAVDAGINALVK	biorepCdiff_8
277	822.56	1643.11	1642.76	87	KHSLFDYYGAEDAK	biorepCdiff_8
57	528.97	1055.93	1055.57	32	LGQEIGLGNR	biorepCdiffA_7
197	466.03	1395.08	1394.71	39	LPFIHFFDGFR	biorepCdiff_8
27	461.27	920.52	920.46	41	NPFTLDSK	biorepCdiffA_8
202	676.51	1351.01	1350.65	34	QFPEEADGLFAK	biorepCdiff_7
440	1095.83	2189.64	2188.96	29	QPLMEFSGACAGCGETAYIK	biorepCdiff_8
257	881.68	1761.34	1760.89	50	TKEPGSTGEPLYLDVR	biorepCdiffA_7
416	1055.32	2108.63	2107.99	63	TVANEAQAVACGYWHLYR	biorepCdiff_8
138	689.16	1376.30	1375.70	35	TVFDNLVSEQPK	biorepCdiffA_7
261	518.27	1551.79	1550.86	38	VAGELLPGVFHVSAR	biorepCdiff_8
112	537.46	1072.90	1072.56	28	VDVMPANTVK	biorepCdiff_7
89	545.22	1088.43	1088.55	26	VDVMPANTVK +Oxidation (M)	biorepCdiff_8
482	857.68	2570.01	2569.27	66	VELLENEDYASLLNFEAVQAFR	biorepCdiffA_1
179	815.43	1628.85	1628.77	59	VEVPASWENAVDADK	biorepCdiffA_8
354	953.68	1905.35	1904.89	28	VVELLEKPACDCTDEK	biorepCdiff_8
107	525.97	1049.93	1049.55	42	VVTQLYGDR	biorepCdiff_7
135	685.98	1369.94	1369.58	64	YAQAYFDYDSK	biorepCdiffA_7
148	663.50	1324.99	1324.70	47	YYQNIVGIVEK	biorepCdiff_8

Matching Genes:

gi|115251733|emb|CAJ69568.1| (pyruvate-flavodoxin oxidoreductase [Clostridium difficile 630])

Protein Group 2

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
796	36	14	11	49

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
92	498.32	994.62	994.52	67	AEAHIQAGAK	biorepCdiff_5
97	505.98	1009.94	1009.65	44	AIGLVIPSLK	biorepCdiff_7
108	619.26	1236.51	1237.64	71	DKAEAHIQAGAK	biorepCdiffA_5
294	718.08	1434.15	1433.74	53	FEVVAINDLTDAK	biorepCdiff_5
45	468.51	935.00	934.48	38	FNGEIEVK	biorepCdiffA_5
631	1212.98	2423.95	2423.15	33	GLMTTIHAYTNDQNTLDGPHPK	biorepCdiff_5
177	649.99	1297.97	1297.76	65	KVVISAPATGDLK	biorepCdiffA_3
512	775.95	2324.84	2324.10	28	MMEQQDKFEVVAINDLTDAK	biorepCdiffA_5
508	927.52	2779.55	2778.36	75	NPADLPWAELGVDIVLECTGFFTSK	biorepCdiffA_1
348	660.06	1318.10	1317.66	54	NVTVEEINAAMK	biorepCdiff_2
110	556.50	1110.98	1110.61	51	TLGYFAQLAK	biorepCdiffA_1
579	887.35	1772.68	1771.98	98	VPVVTGSITELVCTLGK	biorepCdiff_2
230	586.08	1170.14	1169.67	54	VVISAPATGDLK	biorepCdiff_3
635	1046.29	2090.56	2089.98	65	VVSWYDNEMSYTSQLIR	biorepCdiff_2

Matching Genes:

gi|115252231|emb|CAJ70071.1| (glyceraldehyde-3-phosphate dehydrogenase 2 [Clostridium difficile 630])

Protein Group 3

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
771	41	18	11	26

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
130	681.60	1361.19	1360.69	34	AVTDLLDEMNIK	biorepCdiffA_7
106	641.46	1280.92	1280.55	40	DMYLNSYYGR	biorepCdiffA_7
45	497.84	993.67	994.47	34	ENMLWFR	biorepCdiffA_7
137	688.54	1375.06	1374.78	48	FQSLLVAIEDLK	biorepCdiffA_7
255	1011.07	2020.13	2019.92	56	HTTFFEVEPDPTLECAK	biorepCdiffA_8
171	714.98	1427.94	1427.69	25	IFATYSQEQVDK	biorepCdiffA_7
119	560.02	1118.02	1117.65	58	IFLAASLAANK	biorepCdiff_7
259	1019.21	2036.41	2036.06	28	ILINTPSSQGGIGDLYNFK	biorepCdiffA_8
84	588.52	1175.02	1174.62	36	LAGFEVPVDTK	biorepCdiffA_7
99	511.54	1021.07	1020.57	30	LSPVLAMYK	biorepCdiff_7
444	774.90	2321.68	2321.09	44	LVEDGGFGHTSSLYIDDVNQR	biorepCdiffA_1
276	818.59	1635.17	1634.74	50	NHYASEYIYNAYK	biorepCdiff_8
158	621.64	1241.27	1240.71	49	NIILVNGGLNSK	biorepCdiff_7
102	516.51	1031.01	1030.60	48	TAVNSILVSK	biorepCdiff_7
235	562.91	1685.72	1684.78	27	TCGVIEKDEAFGMTK	biorepCdiffA_7
503	1064.84	2127.67	2127.07	58	VLIGEVESVEIEEAFAHEK	biorepCdiff_7
39	485.95	969.88	969.57	47	VPLAIMAQK	biorepCdiffA_7
125	570.46	1138.90	1138.64	59	YAGIASFLGLK	biorepCdiff_7

Matching Genes:

gi|115252023|emb|CAJ69859.1| (aldehyde-alcohol dehydrogenase [includes: alcohol dehydrogenase and pyruvate-formate-lyase deactivase [Clostridium difficile 630])

Protein Group 4

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
674	33	12	10	31

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
59	530.02	1058.02	1057.60	50	AVTVAVEELK	biorepCdiffA_6
94	496.36	990.71	990.48	67	EADLSMLGR	biorepCdiff_6
489	883.93	2648.76	2648.36	57	EMLQDIAILTGAQVISEELGYDLK	biorepCdiffA_1
269	767.05	1532.09	1531.82	73	FGSPLITNDGVTIAK	biorepCdiffA_2
77	468.40	934.78	934.51	57	GTFDVVAVK	biorepCdiff_6
380	717.30	2148.87	2148.22	57	ISNIQELLPVLEQIVQQGK	biorepCdiffA_6
588	760.02	2277.03	2276.31	33	KISNIQELLPVLEQIVQQGK	biorepCdiff_6
139	587.52	1173.02	1172.65	52	LIAEAMEIVGK	biorepCdiff_6
163	619.96	1237.91	1237.71	33	NVTAGANPILLR	biorepCdiff_6
520	1105.38	3313.11	3312.68	51	QIAINAGLEGAVIVQNVVNSEAETGFDALNEK	biorepCdiffA_2
360	1044.88	2087.75	2087.09	85	TNDVAGDGTTTATVLAQAIIR	biorepCdiffA_6
53	508.88	1015.74	1015.55	59	VGAATEVELK	biorepCdiffA_6

Matching Genes:

gi|115249204|emb|CAJ67016.1| (60 kDa chaperonin [Clostridium difficile 630])

Protein Group 5

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
538	23	12	6	49

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
637	847.80	2540.39	2539.30	78	AYEGGFAIGAFNISDLEQLQGVLK	biorepCdiff_4
53	530.36	1058.71	1058.56	44	DAIQAVVESK	biorepCdiffA_4
89	611.51	1221.01	1220.63	40	FDILEEIQSK	biorepCdiffA_4
87	609.58	1217.14	1216.59	31	IDDVLGSANSIN	biorepCdiffA_4
130	489.51	977.00	976.46	52	INMDTDLR	biorepCdiff_4
29	423.97	845.93	845.48	32	LAMTAAIR	biorepCdiff_4
371	781.14	1560.27	1559.73	38	NSYVMIQASMSAVK +2 Oxidation (M)	biorepCdiff_4
654	911.80	2732.39	2732.18	30	TCIDAGFSSVMIDGSHFDFEENVR	biorepCdiff_4
275	873.23	1744.44	1743.92	54	TGVDSLAIAIGTSHGAFK	biorepCdiffA_4
162	672.98	1343.94	1343.69	39	YAGPHTLVEMVK	biorepCdiffA_4
171	680.96	1359.90	1359.69	38	YAGPHTLVEMVK +Oxidation (M)	biorepCdiffA_4
481	770.11	1538.20	1537.74	62	YTQPAEAVEFVER	biorepCdiff_3

Matching Genes:

gi|115249409|emb|CAJ67224.1| (putative fructose-bisphosphate aldolase [Clostridium difficile 630])

Protein Group 6

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
528	14	10	8	24

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
387	1086.79	2171.57	2171.01	38	ESDDVFYTWAGPEVAVASTK	biorepCdiffA_6
417	611.49	1831.46	1830.90	49	FESQTDTEVIAHLVDK	biorepCdiff_6
372	861.28	1720.55	1719.92	32	FVNIPVITDIASEFR	biorepCdiff_6
150	679.52	1357.03	1356.71	49	GAYVVAIAQSHNK	biorepCdiffA_6
105	614.52	1227.03	1226.69	45	GTPVIAIATQEK	biorepCdiffA_6
295	749.53	1497.04	1496.67	91	GYDSAGVAVNSSNEK	biorepCdiff_6
298	754.11	1506.20	1505.76	48	IQEILDNEEYIK	biorepCdiff_6
112	622.47	1242.93	1242.72	81	KAAEVIVEGLSK	biorepCdiffA_6
279	733.56	1465.10	1464.74	48	TVVSSEHAFYLGR	biorepCdiff_6
580	754.05	2259.14	2258.03	47	WATHGEPSDVNSHPHFNQAK	biorepCdiff_6

Matching Genes:

gi|115249129|emb|CAJ66940.1| (glucosamine--fructose-6-phosphate aminotransferase [isomerizing] [Clostridium difficile 630])

Protein Group 7

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
518	21	13	7	38

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
376	864.89	1727.76	1727.89	44	ALCEELLAMPVVAGQK	biorepCdiff_6
387	880.10	1758.18	1757.88	46	ALQSGTSHFLGQHFTK	biorepCdiff_6
139	669.02	1336.03	1335.62	51	DIENNQAMVFR	biorepCdiffA_6
583	1132.83	2263.64	2263.07	60	EAEHVEGFAPEVAWVTHGGNK	biorepCdiff_6
413	914.16	1826.31	1825.82	42	EDNTSIVENMDEFRK	biorepCdiff_6
426	931.12	1860.22	1859.86	32	EGNLANPYHTSWGASTR	biorepCdiff_6
448	963.18	1924.34	1923.90	53	GVAVEVDDRDNYTTGWK	biorepCdiff_6
120	559.34	1116.67	1116.61	32	IKEETGATIR	biorepCdiff_6
485	1022.34	2042.67	2042.00	26	LCVRPTSETIICTMYAK	biorepCdiff_6
439	944.71	1887.40	1886.84	33	MEDDFPQWYTDVITK	biorepCdiff_6
95	497.35	992.69	992.52	40	QFVEEITK	biorepCdiff_6
66	560.91	1119.80	1119.58	34	TDLVDYAPVK	biorepCdiffA_6
171	709.70	1417.38	1416.91	25	VAPIQVVIVPIAAK	biorepCdiffA_6

Matching Genes:

gi|115249053|emb|CAJ66864.1| (putative dual-specificity prolyl/cysteinyl-tRNA synthetase [Clostridium difficile 630])

Protein Group 8

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
479	18	7	6	39

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
602	946.20	1890.39	1889.90	85	EAEQAGADFVGAEELVQK	biorepCdiff_3
234	594.95	1187.89	1187.58	27	FDETVEAHIK	biorepCdiff_3
594	936.27	1870.53	1869.94	124	FYDASEALTLVSDIAGAK	biorepCdiff_3
492	790.63	1579.24	1578.83	73	LTENFTALMDAIIK	biorepCdiff_3
88	512.89	1023.76	1023.52	56	SGTVTFDVAK	biorepCdiffA_3
260	617.57	1233.13	1232.64	67	SITVASSMGPGVK	biorepCdiff_3
151	539.48	1076.94	1076.63	47	TNIIHVPVGK	biorepCdiff_4

Matching Genes:

gi|115249066|emb|CAJ66877.1| (50S ribosomal protein L1 [Clostridium difficile 630])

Protein Group 9

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
454	21	8	7	29

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
423	683.38	2047.12	2046.08	41	AAADEIGLPLFQYLGGVNAK	biorepCdiffA_5
641	1237.05	2472.08	2471.17	28	AGYKPGEDVMLGLDVAATEMYNK	biorepCdiff_6
394	888.20	1774.39	1773.93	81	AIVPSGASTGAFEAVELR	biorepCdiff_6
210	665.03	1328.06	1327.76	65	EALELIVEAITK	biorepCdiff_6
196	657.54	1313.07	1312.73	57	GIENGVANSILVK	biorepCdiff_6
84	560.03	1118.04	1117.56	65	MGAEVFHSLK	biorepCdiffA_5
394	1095.40	2188.79	2188.09	69	SGETEDSTIADLAVAVNAGQIK	biorepCdiffA_6
57	525.50	1048.98	1048.59	48	SVIELVYAR	biorepCdiffA_6

Matching Genes:

gi|115252227|emb|CAJ70067.1| (enolase [Clostridium difficile 630])

Protein Group 10

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
445	15	11	5	18

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
271	484.38	1450.13	1449.69	37	AGAPFAPGANPMHGR	biorepCdiff_7
334	1033.44	2064.87	2064.92	43	FEPITSEYLDYDEVMSK	biorepCdiffA_7
141	460.73	1379.17	1378.73	53	KLWDEAMVLFK	biorepCdiffA_7
102	626.61	1251.20	1250.64	31	LWDEAMVLFK	biorepCdiffA_7
273	923.66	1845.32	1844.86	30	MAESYGFDISKPATNSK	biorepCdiffA_7
43	491.35	980.69	980.45	31	MNAWQGFK	biorepCdiffA_7
368	1066.36	2130.71	2129.93	34	MVENSCEAFGYELDPEIK	biorepCdiffA_7
132	660.47	1318.93	1318.69	53	SGIITGLPDAYGR	biorepCdiffA_6
67	549.47	1096.92	1096.59	33	VSGYAVNFIK	biorepCdiffA_7
308	986.71	1971.41	1970.89	60	VSIDTSSVQYENDDLMR	biorepCdiffA_7
209	533.48	1597.43	1596.72	40	YSYEALEMALHDR	biorepCdiffA_7

Matching Genes:

gi|115249776|emb|CAJ67593.1| (formate acetyltransferase [Clostridium difficile 630])

Protein Group 11

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
441	34	7	6	52

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
125	452.50	902.98	902.53	50	AFLGLLNR	biorepCdiff_2
492	746.18	1490.34	1489.80	91	FAELLGEVVVADTK	biorepCdiff_2
751	1320.42	2638.82	2638.14	28	FVCTVCGYIHEGDAAPAQCPVCK	biorepCdiff_3
117	591.43	1180.85	1180.61	65	IALEEAEHAAK	biorepCdiffA_2
309	849.63	1697.25	1696.90	86	IGVAQGVDEEIIEGLR	biorepCdiffA_1
335	577.44	1152.87	1152.55	56	VGADKFEEMK	biorepCdiff_1
196	691.02	1380.03	1379.67	65	VRVDAEYGATDGK	biorepCdiffA_1

Matching Genes:

gi|115250515|emb|CAJ68339.1| (putative ruberythrin [Clostridium difficile 630])

Protein Group 12

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
431	35	7	6	52

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
125	452.50	902.98	902.53	50	AFLGLLNR	biorepCdiff_2
492	746.18	1490.34	1489.80	91	FAELLGEVVVADTK	biorepCdiff_2
751	1320.42	2638.82	2638.14	28	FVCTVCGYIHEGDAAPAQCPVCK	biorepCdiff_3
267	608.44	1214.86	1214.59	63	IAFEEAEHAAK	biorepCdiff_2
290	820.64	1639.27	1638.89	78	IGVAQGVDAEIIEGLR	biorepCdiffA_1
335	577.44	1152.87	1152.55	56	VGADKFEEMK	biorepCdiff_1
196	691.02	1380.03	1379.67	65	VRVDAEYGATDGK	biorepCdiffA_1

Matching Genes:

gi|115250565|emb|CAJ68389.1| (putative rubrerythrin [Clostridium difficile 630])

Protein Group 13

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
429	17	9	6	25

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
527	680.71	2039.10	2038.93	71	AAQEQQAAQGAEQAQDNGPK	biorepCdiff_4
532	1053.66	3157.97	3157.42	28	AAQEQQAAQGAEQAQDNGPKDDNVVDADFK	biorepCdiffA_7
366	1065.35	2128.68	2128.03	45	EKIEAFNQAESTIYQTEK	biorepCdiffA_7
589	803.60	2407.78	2407.19	29	ELSSTMSSNINLPFITATAEGPK	biorepCdiff_7
72	477.91	953.80	953.55	44	IPAVQEAVK	biorepCdiff_7
351	946.26	1890.51	1889.96	77	ITITSNTNLSEAEIEQK	biorepCdiff_8
609	834.30	2499.88	2499.24	57	SQIFSTAADNQTAVDIHVLQGER	biorepCdiff_7
319	796.12	1590.22	1589.87	25	SYTPQEISAIILQK	biorepCdiff_7
436	792.33	2373.96	2373.20	53	TALQDAGLSTGDIDDVLLVGGSTR	biorepCdiffA_7

Matching Genes:

gi|115251515|emb|CAJ69348.1| (chaperone protein [Clostridium difficile 630])

Protein Group 14

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
427	19	7	5	48

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
420	711.07	1420.12	1419.67	80	EIMDAANNTGASVK	biorepCdiff_3
180	670.06	1338.11	1337.72	74	IVYDAFAIVAEK	biorepCdiffA_2
235	558.91	1115.81	1115.60	57	LINNLMVDGK	biorepCdiff_2
430	696.54	1391.07	1390.69	54	REVLPDPMYGSK	biorepCdiff_2
378	647.48	1939.43	1939.04	35	RVGGANYQVPIEVRPER	biorepCdiffA_2
289	618.92	1235.83	1235.60	94	TGEEALEVFNK	biorepCdiff_2
559	892.74	1783.47	1782.94	33	VGGANYQVPIEVRPER	biorepCdiff_3

Matching Genes:

gi|115249073|emb|CAJ66884.1| (30S ribosomal protein S7 [Clostridium difficile 630])

Protein Group 15

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
421	12	8	6	33

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
368	794.28	1586.54	1585.88	27	AADPIVVLFGATSIGR	biorepCdiff_5
76	545.45	1088.89	1088.55	48	ATIDAGWLDK	biorepCdiffA_5
599	760.02	2277.04	2276.15	60	ENLDILYELAEIIGGEVSGSR	biorepCdiff_5
489	987.28	1972.55	1971.96	74	IHTGLTADCTGLAVAEDTK	biorepCdiff_5
118	629.63	1257.25	1256.69	69	MGNVLVVIEQR	biorepCdiffA_5
268	699.21	1396.40	1395.83	54	VLPELISQLSVAK	biorepCdiff_5
28	444.36	886.71	886.55	39	VSALLLGSK	biorepCdiffA_5
183	637.10	1272.18	1271.65	50	YADVGIVGDVHK	biorepCdiff_5

Matching Genes:

gi|115250077|emb|CAJ67897.1| (electron transfer flavoprotein alpha-subunit [Clostridium difficile 630])

Protein Group 16

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
413	15	11	2	21

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
521	1086.44	2170.86	2170.04	29	ATYTMIFDHYEQVPASVAK	biorepCdiff_7
129	681.54	1361.07	1361.74	39	EDSFIGIIDLLK	biorepCdiffA_7
210	679.57	1357.13	1356.64	38	GGVEPQSENVWR	biorepCdiff_7
79	580.43	1158.84	1158.55	27	GILADGEEAER	biorepCdiffA_7
314	782.82	1563.63	1563.72	29	HSSDEEPFSALAFK	biorepCdiff_7
509	713.51	2137.51	2136.87	39	IGETHEGASQMDWMEQEK +2 Oxidation (M)	biorepCdiff_7
161	625.49	1248.97	1248.62	37	LAEEDPTFTVK	biorepCdiff_7
285	741.64	1481.27	1480.81	50	LNSNAVPMQLPIGK	biorepCdiff_7
37	480.86	959.70	959.52	35	VGAPQVAYR	biorepCdiffA_7
266	895.26	1788.50	1787.89	56	VYSGTLESGSYVLNATK	biorepCdiffA_7
200	776.77	1551.52	1550.77	34	YLEGEELTIDELK	biorepCdiffA_7

Matching Genes:

gi|115249074|emb|CAJ66885.1| (translation elongation factor G [Clostridium difficile 630])

Protein Group 17

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
413	16	10	6	29

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
380	964.80	1927.59	1927.01	43	DKYPGLIFSQILGYGEK	biorepCdiffA_5
275	706.04	1410.07	1409.65	37	ENPNSPLMTTYK +Oxidation (M)	biorepCdiff_5
47	495.37	988.72	988.53	44	IVGEAMLEK	biorepCdiffA_6
322	739.20	1476.38	1475.80	40	LLSEADIFVTNVR	biorepCdiff_5
97	519.94	1037.86	1037.52	34	MGIAYDQIK	biorepCdiff_5
147	609.91	1217.81	1217.61	42	MLGDWGAEVIK	biorepCdiff_5
160	617.98	1233.95	1233.61	36	MLGDWGAEVIK +Oxidation (M)	biorepCdiff_5
452	1061.76	2121.51	2120.93	33	SPASDDENPMFELENGNKK	biorepCdiffA_5
512	1053.28	2104.55	2105.02	60	TLDEWSALLEEADLPFEK	biorepCdiff_6
196	695.72	1389.42	1388.78	44	WIQLALIQYNK	biorepCdiffA_5

Matching Genes:

gi|115249401|emb|CAJ67216.1| (isocaprenoyl-CoA:2-hydroxyisocaproate CoA-transferase [Clostridium difficile 630])

Protein Group 18

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
398	18	7	7	50

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
51	457.46	912.90	912.56	52	AVLELAGLK	biorepCdiffA_3
607	637.43	1909.27	1909.01	41	FAALVVVGDENGHVGIGAGK	biorepCdiff_3
738	1231.92	2461.82	2461.29	68	GHFGAGNILIMPAVEGTGVIAGGPAR	biorepCdiff_3
739	1240.02	2478.03	2477.28	56	GHFGAGNILIMPAVEGTGVIAGGPAR +Oxidation (M)	biorepCdiff_3
435	728.08	1454.15	1453.78	72	KPIDAGQLDLQEK	biorepCdiff_3
584	929.39	1856.77	1856.09	57	NLIVVPIVGTTIPHEVR	biorepCdiff_3
538	537.79	1610.35	1609.88	52	RKPIDAGQLDLQEK	biorepCdiff_2

Matching Genes:

gi|115249094|emb|CAJ66905.1| (30S ribosomal protein S5 [Clostridium difficile 630])

Protein Group 19

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
353	12	7	3	41

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
304	797.08	1592.15	1591.86	65	APVSNFAYLIDAIAK	biorepCdiffA_3
209	687.46	1372.91	1372.76	56	GLTVEEVTELRK	biorepCdiffA_3
113	565.50	1128.99	1128.60	30	IVEMANIPSR	biorepCdiffA_3
221	573.39	1144.77	1144.59	39	IVEMANIPSR +Oxidation (M)	biorepCdiff_3
432	723.50	1444.99	1444.65	37	MGIVEGAFYDESK	biorepCdiff_3
110	559.93	1117.85	1117.59	38	SEVVSEIVEK	biorepCdiffA_3
191	520.04	1038.08	1037.54	88	SSAAVVVDYK	biorepCdiff_3

Matching Genes:

gi|115249067|emb|CAJ66878.1| (50S ribosomal protein L10 [Clostridium difficile 630])

Protein Group 20

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
347	26	6	5	34

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
495	970.46	1938.91	1937.95	82	AFGGADTWATSNTIAAGISK	biorepCdiff_4
453	694.54	2080.61	2080.03	39	DGVPSILNPDDANALEEALK	biorepCdiffA_3
256	871.15	1740.29	1739.87	68	QAIDGDTAQVGPQIAEK	biorepCdiffA_6
84	604.44	1206.87	1206.61	58	QLEDGYELIK	biorepCdiffA_4
255	613.55	1225.08	1224.61	55	VGDYDIIFAGR	biorepCdiff_3
65	564.57	1127.12	1126.70	45	VSTPVLLTAVK	biorepCdiffA_4

Matching Genes:

gi|115249406|emb|CAJ67221.1| (electron transfer flavoprotein beta-subunit [Clostridium difficile 630])

Protein Group 21

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
336	11	7	5	31

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
77	494.49	986.97	986.51	32	EVAPALMEK	biorepCdiffA_3
235	598.51	1195.01	1194.63	45	GMDIIFVTTAK	biorepCdiff_3
381	929.78	1857.55	1856.99	60	GVEELEMISGQKPVITK	biorepCdiffA_3
596	937.80	1873.58	1872.99	50	GVEELEMISGQKPVITK +Oxidation (M)	biorepCdiff_3
120	579.95	1157.89	1157.62	63	IVINMGIGDAR	biorepCdiffA_3
124	587.98	1173.94	1173.62	39	IVINMGIGDAR +Oxidation (M)	biorepCdiffA_3
31	435.92	869.82	869.53	47	LVSVSLPR	biorepCdiffA_3

Matching Genes:

gi|115249089|emb|CAJ66900.1| (50S ribosomal protein L5 [Clostridium difficile 630])

Protein Group 22

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
330	15	7	4	38

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
436	670.23	2007.66	2007.14	43	GVVIPVTAVEAGPMVVTQIK	biorepCdiffA_3
642	1012.89	2023.77	2023.14	33	GVVIPVTAVEAGPMVVTQIK +Oxidation (M)	biorepCdiff_3
10	416.84	831.66	831.47	32	IDVTGISK	biorepCdiffA_3
630	992.75	1983.49	1982.96	66	TVDKDGYNAIQIGFEDAK	biorepCdiff_3
283	762.50	1522.98	1522.75	61	VDSVEGYTVGQEIK	biorepCdiffA_3
116	570.39	1138.77	1138.57	68	VGMTQIFTDK	biorepCdiffA_3
163	565.09	1128.16	1127.65	27	VTVQNLEVVK	biorepCdiff_4

Matching Genes:

gi|115249077|emb|CAJ66888.1| (50S ribosomal protein L3 [Clostridium difficile 630])

Protein Group 23

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
328	11	5	5	28

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
438	699.59	1397.17	1396.76	63	AEIGLTYIYGIGK	biorepCdiff_2
168	659.40	1316.78	1316.62	69	DLSEDQVNELR	biorepCdiffA_2
238	723.50	1444.99	1444.72	45	DLSEDQVNELRK	biorepCdiffA_2
25	420.86	839.70	839.49	62	IAGVDLPR	biorepCdiffA_2
526	780.05	1558.08	1557.80	89	IKDLSEDQVNELR	biorepCdiff_2

Matching Genes:

gi|115249103|emb|CAJ66914.1| (30S ribosomal protein S13 [Clostridium difficile 630])

Protein Group 24

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
328	11	6	6	26

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
245	607.92	1213.83	1213.67	75	AGENLLSLLER	biorepCdiff_3
489	783.04	1564.07	1564.81	72	QLVTHGHFTLNGNK	biorepCdiff_3
74	492.40	982.79	982.61	40	VDIPSLIVK	biorepCdiffA_3
92	525.37	1048.72	1048.57	40	VSNYGLQLR	biorepCdiffA_3
364	675.01	1348.01	1347.65	58	WLEANVEGMTAK	biorepCdiff_3
374	683.00	1363.98	1363.64	43	WLEANVEGMTAK +Oxidation (M)	biorepCdiff_3

Matching Genes:

gi|115249105|emb|CAJ66916.1| (30S ribosomal protein S4 [Clostridium difficile 630])

Protein Group 25

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
318	12	5	4	27

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
375	616.54	1231.06	1230.61	44	AADDAAGLAISEK	biorepCdiff_1
260	558.60	1672.78	1671.87	30	IADELTQLKDEIER	biorepCdiffA_4
389	839.66	1677.30	1676.84	48	IRDTDVASEMVNLSK	biorepCdiff_5
452	1159.82	2317.62	2317.11	124	LESTQNNLNNTLENVTAAESR	biorepCdiffA_4
297	910.24	1818.47	1817.88	72	TLSLQSANEINNTEER	biorepCdiffA_4

Matching Genes:

gi|115249247|emb|CAJ67060.1| (flagellin subunit [Clostridium difficile 630])

Protein Group 26

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
318	11	8	4	20

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
184	641.51	1281.00	1280.66	40	ESTIEFLTSVR	biorepCdiff_6
88	592.39	1182.77	1182.63	52	GISDFLLSFGK	biorepCdiffA_6
301	759.13	1516.24	1515.83	30	GNVLEGLKPESVFK	biorepCdiff_6
596	1151.74	2301.46	2301.01	52	HEFTTSDPGMTYSVAETSVDK	biorepCdiff_6
600	1159.81	2317.61	2317.01	32	HEFTTSDPGMTYSVAETSVDK +Oxidation (M)	biorepCdiff_6
277	485.74	1454.20	1453.76	28	NVEHDFLKDPIK	biorepCdiff_6
191	648.02	1294.02	1293.66	35	TCVVSLPVEYK	biorepCdiff_6
469	990.29	1978.56	1978.03	49	VLSVLNVDYELASVDGGTK	biorepCdiff_6

Matching Genes:

gi|115249724|emb|CAJ67541.1| (putative aminoacyl-histidine dipeptidase [Clostridium difficile 630])

Protein Group 27

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
318	18	7	4	37

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
17	416.89	831.76	831.45	37	CLALLDK	biorepCdiff_4
541	692.32	2073.94	2073.12	50	ILIPMINEAVGIYADGVASK	biorepCdiff_4
657	922.74	2765.19	2764.33	26	LAVIGSGTMGSGIVQTFASCGHDVCLK	biorepCdiff_4
29	445.75	889.49	889.46	33	LLDELCK	biorepCdiffA_4
701	1052.23	3153.68	3152.60	46	LLDELCKEDTILATNTSSLSITEIASSTK	biorepCdiff_4
121	637.50	1272.99	1272.73	53	LVEVISGQLTSK	biorepCdiffA_4
130	643.53	1285.05	1284.66	73	VTFDTVFELSK	biorepCdiffA_4

Matching Genes:

gi|115250079|emb|CAJ67899.1| (3-hydroxybutyryl-CoA dehydrogenase [Clostridium difficile 630])

Protein Group 28

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
316	13	7	4	35

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
156	443.72	1328.12	1327.73	31	ALENVLKDDLAK	biorepCdiffA_4
80	596.48	1190.95	1190.62	32	EALEFVNEIK	biorepCdiffA_4
187	611.03	1220.05	1219.62	54	GLYGELANEVR	biorepCdiff_4
142	652.44	1302.87	1302.60	52	IGAQNMHFEEK	biorepCdiffA_4
235	808.53	1615.04	1614.75	58	QYFNETDETVNKK	biorepCdiffA_4
249	820.12	1638.22	1637.79	60	TATAEDANDVISYIR	biorepCdiffA_4
386	802.17	1602.33	1601.88	29	VVVAYEPIWAIGTGK	biorepCdiff_4

Matching Genes:

gi|115252229|emb|CAJ70069.1| (triosephosphate isomerase [Clostridium difficile 630])

Protein Group 29

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
314	12	7	3	29

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
489	743.02	2226.04	2225.15	28	DAIDEIKPEIMLFGATHIGR	biorepCdiffA_5
132	497.41	992.80	992.52	36	ELITFGADK	biorepCdiff_4
235	683.53	1365.05	1364.80	68	IAPVVIELLGEGR	biorepCdiff_6
169	701.52	1401.03	1400.74	48	LDSVDDLLEAIKA	biorepCdiffA_6
538	1006.59	3016.76	3015.60	38	NPAAPILEIADYGVVGDLHEIVPMLIEK	biorepCdiffA_4
133	581.96	1161.90	1161.59	27	NVWIFAEQR	biorepCdiff_5
79	554.90	1107.78	1107.58	69	TGEVIALDYK	biorepCdiffA_5

Matching Genes:

gi|115249407|emb|CAJ67222.1| (electron transfer flavoprotein alpha-subunit [Clostridium difficile 630])

Protein Group 30

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
310	15	7	5	40

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
483	733.18	1464.34	1463.75	41	FENGTEITAELLK	biorepCdiff_2
193	486.85	971.69	971.53	46	ILGEGNLEK	biorepCdiff_2
171	440.63	1318.87	1318.74	25	LHELKPAEGAVR	biorepCdiffA_2
536	532.38	1594.11	1593.87	30	MKLHELKPAEGAVR +Oxidation (M)	biorepCdiff_2
305	631.43	1260.85	1260.63	61	VGFEGGQMPLAR	biorepCdiff_2
320	639.47	1276.93	1276.62	51	VGFEGGQMPLAR +Oxidation (M)	biorepCdiff_2
234	718.06	1434.11	1433.75	56	VYTEVNVEVLNR	biorepCdiffA_2

Matching Genes:

gi|115249096|emb|CAJ66907.1| (50S ribosomal protein L15 [Clostridium difficile 630])

Protein Group 31

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
310	11	7	2	20

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
207	652.59	1303.16	1302.71	36	ALQLHGGYGFIK	biorepCdiff_5
176	631.42	1260.83	1260.59	32	ELDTLPAEMDK	biorepCdiff_5
55	523.93	1045.84	1045.56	71	IAMGTLEVGR	biorepCdiffA_7
104	532.02	1062.03	1061.55	29	IAMGTLEVGR +Oxidation (M)	biorepCdiff_5
410	627.57	1879.67	1879.08	74	IGVAALALGIAQGALDEAVK	biorepCdiff_7
224	485.13	1452.37	1451.75	34	IVSIYEGTSEVQK	biorepCdiffA_5
89	495.93	989.84	989.56	34	MVISSNVLK	biorepCdiff_5

Matching Genes:

gi|115249405|emb|CAJ67220.1| (acyl-CoA dehydrogenase, short-chain specific [Clostridium difficile 630])

Protein Group 32

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
305	15	7	4	25

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
747	1058.90	3173.69	3173.59	52	ALEAANMTIEDIDLVEANEAFAAQSVAVIR	biorepCdiff_5
189	738.08	1474.14	1473.69	50	EEQDELALASQNK	biorepCdiffA_6
141	644.50	1286.98	1286.71	47	FDEEIVPVVIK	biorepCdiffA_5
152	612.97	1223.93	1223.68	34	ILTTLLYEMK	biorepCdiff_6
121	567.42	1132.83	1132.60	39	IMGYGPVPATK	biorepCdiff_5
157	616.45	1230.89	1230.68	38	SVSAVELGVTAAK	biorepCdiff_6
66	521.46	1040.90	1040.53	45	TAVGSFGGAFK	biorepCdiffA_5

Matching Genes:

gi|115250080|emb|CAJ67900.1| (acetyl-CoA acetyltransferase [Clostridium difficile 630])

Protein Group 33

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
290	10	8	2	29

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
337	748.28	1494.54	1493.72	30	DVNVFEMAQSQVK	biorepCdiff_5
42	464.70	927.38	927.47	27	GYIDGIYK	biorepCdiffA_5
244	682.11	1362.20	1361.73	46	LGMEPAVYELLK	biorepCdiff_5
594	1130.95	2259.89	2259.22	43	LTGQSSIGVITGKPVEFGGSLGR	biorepCdiff_5
587	1138.86	2275.70	2275.04	39	LVCEAANGPTTPEADEVFAER	biorepCdiff_6
650	1285.59	2569.16	2568.11	39	SEGSYAIYNENGLDGQAMLDYMK	biorepCdiff_5
149	611.41	1220.80	1220.65	27	TAATGFGVAVTAR	biorepCdiff_5
45	492.40	982.78	982.61	39	VIEVSIPVK	biorepCdiffA_6

Matching Genes:

gi|115249189|emb|CAJ67001.1| (NAD-specific glutamate dehydrogenase [Clostridium difficile 630])

Protein Group 34

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
284	13	6	6	28

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
469	756.62	1511.23	1510.87	51	ALVVIADKNDNVIK	biorepCdiff_3
243	723.47	1444.92	1444.77	43	EFAQILNNINAAK	biorepCdiffA_3
700	1118.32	2234.62	2234.16	57	NIEGVQTALVNTMNVYDILK	biorepCdiff_3
505	1126.40	2250.79	2250.16	49	NIEGVQTALVNTMNVYDILK +Oxidation (M)	biorepCdiffA_3
328	838.19	1674.37	1673.91	44	TKEFAQILNNINAAK	biorepCdiffA_3
208	687.05	1372.08	1371.69	40	YDSFIITTDAVK	biorepCdiffA_3

Matching Genes:

gi|115249078|emb|CAJ66889.1| (50S ribosomal protein L4 [Clostridium difficile 630])

Protein Group 35

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
274	9	5	4	45

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
482	664.52	1327.02	1326.62	74	HETVDVPASNMK	biorepCdiff_1
105	545.46	1088.91	1088.62	46	ILLEEGFIR	biorepCdiffA_1
274	777.10	1552.19	1551.74	29	KENVGGEVICYVW	biorepCdiffA_2
191	683.02	1364.02	1363.65	53	TMTDPIADMLTR	biorepCdiffA_1
200	694.55	1387.09	1386.81	72	VLNGLGISVISTSK	biorepCdiffA_1

Matching Genes:

gi|115249091|emb|CAJ66902.1| (30S ribosomal protein S8 [Clostridium difficile 630])

Protein Group 36

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
274	9	4	4	9

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
257	872.16	1742.30	1741.87	78	IENQEGVENLDEILK	biorepCdiffA_6
38	483.92	965.82	965.59	47	INLPAITPK	biorepCdiffA_7
308	765.60	1529.19	1528.81	51	SGDSILIDDGLVGLR	biorepCdiff_6
225	674.97	1347.92	1347.65	98	SSVAGNTDEVIEK	biorepCdiff_6

Matching Genes:

gi|115252454|emb|CAJ70297.1| (pyruvate kinase [Clostridium difficile 630])

Protein Group 37

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
269	10	6	4	20

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
304	856.66	1711.31	1710.77	43	ELEEICGYEIEEAK	biorepCdiffA_5
301	852.38	1702.75	1701.73	31	FCDPEEYDYPLVR	biorepCdiffA_5
254	763.52	1525.02	1524.73	56	IHESIEVYNEHR	biorepCdiffA_5
426	884.72	1767.42	1766.79	58	QWSNIEGCSLAYDPK	biorepCdiff_5
119	630.04	1258.07	1257.58	39	TDVPAGDDALER	biorepCdiffA_5
87	565.80	1129.59	1128.68	42	VLLTGILADSK	biorepCdiffA_5

Matching Genes:

gi|115249404|emb|CAJ67219.1| (subunit of oxygen-sensitive 2-hydroxyisocaproyl-CoA dehydratase [Clostridium difficile 630])

Protein Group 38

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
261	7	7	3	15

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
108	646.96	1291.91	1291.61	35	ELISNGCDAVSK	biorepCdiffA_7
114	657.58	1313.14	1312.80	27	EVIPEFLLLLK	biorepCdiffA_7
302	769.63	1537.25	1536.79	33	LYNNQVFVADNIK	biorepCdiff_7
384	895.28	1788.54	1787.87	52	NEDTPAMVLVSEQSIR	biorepCdiff_7
122	671.00	1339.98	1339.77	40	TLVINENSPIIK	biorepCdiffA_7
279	931.59	1861.17	1860.93	29	VFYVSDKEQQSQYIK	biorepCdiffA_7
400	925.72	1849.42	1848.87	45	YINQVAFSGAEDFFNK	biorepCdiff_7

Matching Genes:

gi|115249282|emb|CAJ67095.1| (chaperone protein (heat shock protein) [Clostridium difficile 630])

Protein Group 39

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
256	14	5	5	26

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
294	905.19	1808.36	1807.91	77	AFAGADTWATSSALAGALK	biorepCdiffA_4
661	1041.33	2080.65	2080.07	41	DGVPSIINPDDKAGLEEAIK	biorepCdiff_3
139	650.53	1299.05	1298.67	46	DIEVDPSNLGLK	biorepCdiffA_4
104	550.49	1098.96	1098.60	51	LDPNTGTLIR	biorepCdiffA_3
99	538.91	1075.81	1075.58	41	MPCLITTLK	biorepCdiffA_3

Matching Genes:

gi|115250076|emb|CAJ67896.1| (electron transfer flavoprotein beta-subunit [Clostridium difficile 630])

Protein Group 40

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
254	8	6	4	21

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
405	903.17	1804.33	1803.94	41	AGFVVSDSNIKPDNTLK	biorepCdiff_6
340	815.67	1629.32	1628.81	50	EGFLYLAEAGADFVK	biorepCdiff_6
142	672.48	1342.94	1342.72	60	GQATSIIEVAQAR	biorepCdiffA_6
320	981.21	1960.40	1959.95	30	LSFEEGVDSYVPYAGSLK	biorepCdiffA_6
503	1354.49	2706.97	2706.28	33	VPALVEAGADVLCIDSSEGFSEWQK	biorepCdiffA_6
286	918.74	1835.47	1834.85	40	VSEFMTPMSSIVYANK +2 Oxidation (M)	biorepCdiffA_6

Matching Genes:

gi|115251390|emb|CAJ69222.1| (inosine-5'-monophosphate dehydrogenase [Clostridium difficile 630])

Protein Group 41

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
241	8	5	4	39

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
586	734.19	1466.36	1465.78	46	AGSQVSGPVPLPTEK	biorepCdiff_1
274	798.09	1594.17	1593.87	72	KAGSQVSGPVPLPTEK	biorepCdiffA_1
99	541.49	1080.97	1080.62	49	LIDIANPTPK	biorepCdiffA_1
25	425.91	849.80	849.46	41	LLDFSAGK	biorepCdiffA_1
11	415.17	828.33	827.52	33	QVVTILR	biorepCdiffA_1

Matching Genes:

gi|115249076|emb|CAJ66887.1| (30S ribosomal protein S10 [Clostridium difficile 630])

Protein Group 42

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
231	9	5	3	34

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
640	703.25	2106.72	2105.99	80	MPDLNAASVEAAMSMIAGTAR	biorepCdiff_2
652	713.98	2138.92	2137.98	48	MPDLNAASVEAAMSMIAGTAR +2 Oxidation (M)	biorepCdiff_2
634	1045.88	2089.74	2089.09	43	TADQAGMIIPVVITVYQDR	biorepCdiff_2
637	1053.88	2105.74	2105.08	33	TADQAGMIIPVVITVYQDR +Oxidation (M)	biorepCdiff_2
65	455.35	908.69	908.57	27	TPPAAVLIK	biorepCdiffA_2

Matching Genes:

gi|115249065|emb|CAJ66876.1| (50S ribosomal protein L11 [Clostridium difficile 630])

Protein Group 43

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
221	8	5	3	29

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
139	612.99	1223.96	1223.63	46	AGATYVSPFVGR	biorepCdiffA_3
680	1083.30	2164.58	2164.13	49	EISEIVDGPISAEVISLEHK	biorepCdiff_3
237	720.58	1439.14	1438.73	64	FFIDTANIEEIK	biorepCdiffA_3
146	480.45	958.89	958.52	36	IPMTAEGLK	biorepCdiff_3
213	559.97	1117.93	1117.64	26	NPIHVLQAAR	biorepCdiff_3

Matching Genes:

gi|115251384|emb|CAJ69216.1| (putative transaldolase [Clostridium difficile 630])

Protein Group 44

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
214	4	4	3	4

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
181	687.13	1372.24	1371.72	77	IGAEVDSGDILVGK	biorepCdiff_8
278	824.06	1646.11	1645.81	60	SNSGTCINQTPIINK	biorepCdiff_8
180	817.02	1632.03	1631.85	46	STGPYSLVTQQPLGGK	biorepCdiffA_8
71	501.45	1000.89	1000.58	31	VTADEIIIK	biorepCdiff_8

Matching Genes:

gi|115249070|emb|CAJ66881.1| (DNA-directed RNA polymerase beta chain [Clostridium difficile 630])

Protein Group 45

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
214	8	5	2	40

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
107	556.41	1110.80	1110.64	33	ADLDLRPALK	biorepCdiffA_2
293	823.70	1645.38	1644.81	39	ALENYFNYETLIR	biorepCdiffA_1
166	656.48	1310.95	1310.73	56	LVAGEGNILVNGR	biorepCdiffA_2
123	606.93	1211.84	1211.65	37	QPLVLTGNENK	biorepCdiffA_2
376	965.73	1929.45	1929.06	49	QPLVLTGNENKYDVIVK	biorepCdiffA_2

Matching Genes:

gi|115249113|emb|CAJ66924.1| (30S ribosomal protein S9 [Clostridium difficile 630])

Protein Group 46

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
209	6	5	3	23

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
162	634.47	1266.93	1266.73	50	ALVPVVVEQTGR	biorepCdiffA_3
111	563.42	1124.83	1124.52	34	DNFMSALEAK	biorepCdiffA_3
239	602.43	1202.85	1202.61	45	ETLNEILSER	biorepCdiff_3
186	657.50	1312.98	1312.66	45	EYGLIDEVFTK	biorepCdiffA_3
241	723.05	1444.08	1443.79	35	IKETLNEILSER	biorepCdiffA_3

Matching Genes:

gi|115252361|emb|CAJ70202.1| (ATP-dependent Clp protease proteolytic subunit [Clostridium difficile 630])

Protein Group 47

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
207	7	5	3	17

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
86	561.01	1120.01	1119.58	45	FEGETLPSLK	biorepCdiffA_5
228	731.61	1461.20	1460.73	46	LGWTCASPEILSK	biorepCdiffA_5
152	613.01	1224.01	1223.55	34	LNYSNMPEEK	biorepCdiff_5
289	826.12	1650.22	1649.82	33	MIYVIPDFQNPTGR	biorepCdiffA_5
627	1204.46	2406.90	2406.20	49	TNVNKDDILVTSGSQQGLDFAGK	biorepCdiff_5

Matching Genes:

gi|115252729|emb|CAJ70573.1| (putative amino acid aminotransferase [Clostridium difficile 630])

Protein Group 48

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
205	8	4	3	19

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
292	903.77	1805.53	1804.98	34	ATIGQVGNIEHGNVVIGK	biorepCdiffA_4
146	531.98	1061.95	1061.55	51	SAGVSAQLMAK	biorepCdiff_4
252	825.13	1648.24	1647.86	70	TANIALLNYADGEKR	biorepCdiffA_4
176	589.42	1176.82	1176.58	50	VATIEYDPNR	biorepCdiff_4

Matching Genes:

gi|115249080|emb|CAJ66891.1| (50S ribosomal protein L2 [Clostridium difficile 630])

Protein Group 49

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
199	6	5	1	13

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
307	638.89	1913.64	1912.98	35	AIGDNLTCIFVDHGLLR	biorepCdiffA_6
206	774.54	1547.06	1546.66	34	AVTSSDGMTSDWYK	biorepCdiffA_6
50	445.91	889.80	889.50	33	FDINLIR	biorepCdiff_6
538	1084.23	2166.45	2166.08	67	GIIFTGGPNSAYLEDSPTISK	biorepCdiff_6
88	488.87	975.73	975.54	30	IIGEEFIR	biorepCdiff_6

Matching Genes:

gi|115249206|emb|CAJ67019.1| (GMP synthase [glutamine-hydrolyzing] [Clostridium difficile 630])

Protein Group 50

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
187	6	4	3	5

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
316	526.76	1577.26	1576.73	44	CGTGLASHEVAQGYK	biorepCdiff_7
360	571.43	1711.26	1710.88	49	KGDEVYYVSKPLADK	biorepCdiff_7
157	704.51	1407.01	1406.70	63	LTEELINEGYAR	biorepCdiffA_7
371	873.16	1744.31	1743.81	31	SLEEQNLNDHMTGIK +Oxidation (M)	biorepCdiff_7

Matching Genes:

gi|115251669|emb|CAJ69504.1| (isoleucyl-tRNA synthetase [Clostridium difficile 630])

Protein Group 51

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
183	6	3	2	11

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
383	831.67	1661.32	1660.76	38	AHCSTVGAGEFLQER	biorepCdiff_5
358	839.17	1676.32	1675.81	99	EVVFAADDNVVGENAK	biorepCdiff_6
332	745.55	1489.08	1488.72	46	MENGDVVLLENTR	biorepCdiff_5

Matching Genes:

gi|115252230|emb|CAJ70070.1| (phosphoglycerate kinase [Clostridium difficile 630])

Protein Group 52

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
180	7	4	3	15

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
41	479.51	957.00	956.55	46	AVELLLDGK	biorepCdiffA_4
602	1171.60	2341.19	2340.16	50	GLLEEDLTEMNLSSVGDIIHR	biorepCdiff_4
605	786.65	2356.93	2356.16	32	GLLEEDLTEMNLSSVGDIIHR +Oxidation (M)	biorepCdiff_4
447	908.31	1814.61	1813.94	52	TIGLLTSGGDAPGMNAAIR	biorepCdiff_4

Matching Genes:

gi|115252455|emb|CAJ70298.1| (6-phosphofructokinase [Clostridium difficile 630])

Protein Group 53

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
171	6	4	2	25

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
189	518.32	1034.64	1034.65	34	IILLGPPGAGK	biorepCdiff_3
658	1037.90	2073.78	2073.07	47	IQVYLDETKPLVDYYSK	biorepCdiff_3
571	906.64	1811.27	1810.80	63	VEGVCDVCQGELYQR	biorepCdiff_3
287	511.97	1532.90	1531.78	27	YNIPHISTGDIFR	biorepCdiffA_3

Matching Genes:

gi|115249098|emb|CAJ66909.1| (adenylate kinase [Clostridium difficile 630])

Protein Group 54

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
171	5	4	2	12

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
133	581.92	1161.82	1161.59	30	FPLDTEAELK	biorepCdiff_6
365	1047.36	2092.70	2092.14	48	HVENITQVYGLPAVVAINR	biorepCdiffA_6
629	1206.40	2410.78	2410.15	28	IYGADGVDYTPEADKEIANLEK	biorepCdiff_6
246	857.14	1712.27	1711.87	65	SDIEIAQEAKPQDIR	biorepCdiffA_6

Matching Genes:

gi|115249735|emb|CAJ67552.1| (formate--tetrahydrofolate ligase [Clostridium difficile 630])

Protein Group 55

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
170	5	3	3	44

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
388	1018.26	2034.51	2034.06	44	EQPQIAEVVEVGPGGIVEGK	biorepCdiffA_1
130	610.94	1219.87	1220.64	65	IEGQEYTILR	biorepCdiffA_2
102	543.04	1084.07	1083.63	61	TASGIVLPGAAK	biorepCdiffA_1

Matching Genes:

gi|115249203|emb|CAJ67015.1| (10 kDa chaperonin [Clostridium difficile 630])

Protein Group 56

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
168	6	3	2	27

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
340	858.26	1714.51	1713.88	69	APAFEGNNMVVIIDPK	biorepCdiffA_3
463	749.57	1497.12	1496.79	39	LRPGIEQNDLNTK	biorepCdiff_3
390	940.33	1878.64	1877.97	60	NLDLVQISPNANPPVCK	biorepCdiffA_3

Matching Genes:

gi|115249701|emb|CAJ67518.1| (translation initiation factor IF-3 [Clostridium difficile 630])

Protein Group 57

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
167	5	3	2	26

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
626	978.29	1954.56	1953.98	68	AIANSDLGLNPSNDGEVIR	biorepCdiff_3
29	435.43	868.85	868.44	39	FEFGTIR	biorepCdiffA_3
732	1194.47	2386.94	2386.22	60	VDYYGTPTPINQIGAISVPEPR	biorepCdiff_3

Matching Genes:

gi|115251191|emb|CAJ69022.1| (ribosome recycling factor [Clostridium difficile 630])

Protein Group 58

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
163	4	4	2	14

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
523	1040.78	2079.54	2078.92	53	AAEETGLPYAGFDGDQADPR	biorepCdiff_5
150	652.02	1302.03	1301.66	40	IQGLVEVMEER	biorepCdiffA_5
171	674.03	1346.05	1345.68	36	LLIEELEDNMK	biorepCdiffA_5
333	603.54	1807.61	1806.95	34	VVINDLLAEQYANAFK	biorepCdiffA_5

Matching Genes:

gi|115249403|emb|CAJ67218.1| (subunit of oxygen-sensitive 2-hydroxyisocaproyl-CoA dehydratase [Clostridium difficile 630])

Protein Group 59

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
163	8	3	3	42

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
382	1002.33	2002.64	2002.00	72	LEANAGDVVTLNEVLACSK	biorepCdiffA_1
183	671.61	1341.20	1340.73	50	LGSPVVEGASVQAK	biorepCdiffA_1
273	611.46	1220.91	1220.63	41	VSEGDVLFVEK	biorepCdiff_2

Matching Genes:

gi|115250193|emb|CAJ68014.1| (50S ribosomal protein L21 [Clostridium difficile 630])

Protein Group 60

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
157	6	4	1	23

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
121	580.53	1159.05	1158.68	33	ALVFENVLVR	biorepCdiffA_3
555	891.69	1781.37	1780.85	58	FKPLSQPGQYACEEK	biorepCdiff_3
21	428.38	854.74	854.52	39	LPIALSNK	biorepCdiffA_3
117	573.41	1144.81	1144.58	27	LVGPAGEVEMK +Oxidation (M)	biorepCdiffA_3

Matching Genes:

gi|115251734|emb|CAJ69569.1| (putative propanediol utilization protein [Clostridium difficile 630])

Protein Group 61

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
156	5	3	2	26

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
339	580.48	1158.96	1158.62	50	KAGQICDLVR	biorepCdiff_1
103	543.50	1084.98	1084.61	69	NVDEALAILK	biorepCdiffA_1
285	506.38	1010.74	1010.58	37	TSHIEVVVK	biorepCdiff_1

Matching Genes:

gi|115249082|emb|CAJ66893.1| (50S ribosomal protein L22 [Clostridium difficile 630])

Protein Group 62

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
156	6	3	2	33

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
465	798.62	2392.85	2392.22	34	HKPTFTPHVDGGDFVVVVNAEK	biorepCdiffA_2
344	861.69	1721.37	1720.92	82	KPEEVISHAVSGMLPK	biorepCdiffA_3
229	543.98	1085.95	1085.64	40	LATEIATVLR	biorepCdiff_2

Matching Genes:

gi|115249112|emb|CAJ66923.1| (50S ribosomal protein L13 [Clostridium difficile 630])

Protein Group 63

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
155	5	3	3	20

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
413	845.12	1688.22	1687.71	47	ALDACEDKEDTMYK	biorepCdiff_4
199	619.55	1237.08	1236.59	48	FGVEEIEAESK	biorepCdiff_4
500	976.18	1950.34	1949.87	60	TDEKEVDDENVTDINSK	biorepCdiff_4

Matching Genes:

gi|115251516|emb|CAJ69349.1| (heat shock protein [Clostridium difficile 630])

Protein Group 64

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
152	5	3	2	38

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
412	1073.31	2144.60	2144.06	39	FGVSASAPVMVAGAAAGGPAAEEK	biorepCdiffA_1
602	749.20	1496.39	1495.74	67	TEFDVVLTDVGSSK	biorepCdiff_1
92	528.89	1055.76	1055.62	46	VLELNELVK	biorepCdiffA_1

Matching Genes:

gi|115249068|emb|CAJ66879.1| (50S ribosomal protein L7/L12 [Clostridium difficile 630])

Protein Group 65

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
152	6	3	2	22

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
369	670.54	1339.06	1338.71	31	LYRPANTFVMK	biorepCdiff_2
309	834.06	1666.12	1665.77	57	MLSEMAIQDPEGFAK	biorepCdiffA_2
318	842.12	1682.24	1681.77	64	MLSEMAIQDPEGFAK +Oxidation (M)	biorepCdiffA_2

Matching Genes:

gi|115249703|emb|CAJ67520.1| (50S ribosomal protein L20 [Clostridium difficile 630])

Protein Group 66

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
152	3	3	2	14

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
75	588.95	1175.90	1175.62	48	IPLTIADYDR	biorepCdiffA_4
282	883.15	1764.29	1763.78	73	NVYVSTDDGTYGFNGR	biorepCdiffA_4
436	593.90	1778.67	1777.89	31	QLTDSIYLMEIEAPR	biorepCdiff_4

Matching Genes:

gi|115250577|emb|CAJ68401.1| (putative dehydrogenase, electron transfer subunit [Clostridium difficile 630])

Protein Group 67

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
148	4	4	1	14

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
548	1092.34	2182.67	2182.05	51	ELDIDPIDNPDLDIEEISK	biorepCdiff_6
676	1312.88	2623.74	2624.31	35	GENYNLVIGSNTFIPGFEEQLVGK	biorepCdiff_6
56	525.48	1048.94	1049.58	30	IVIETQYGK	biorepCdiffA_6
14	433.93	865.85	865.44	32	YNIPGFR	biorepCdiffA_6

Matching Genes:

gi|115252362|emb|CAJ70203.1| (trigger factor [Clostridium difficile 630])

Protein Group 68

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
146	4	3	3	20

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
651	904.08	2709.23	2708.25	42	KTEGLQDTQTHYCPGCTHGIIHR	biorepCdiff_4
679	976.91	2927.70	2926.57	40	LVGEVLEELGVLGDAVGVVPVGCSVLGYK	biorepCdiff_4
497	861.42	2581.23	2580.16	64	TEGLQDTQTHYCPGCTHGIIHR	biorepCdiffA_4

Matching Genes:

gi|115249126|emb|CAJ66937.1| (putative subunit of oxidoreductase [Clostridium difficile 630])

Protein Group 69

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
146	3	3	2	17

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
418	870.72	1739.43	1738.88	61	AAALDTFETEGLFLNK	biorepCdiff_5
394	844.22	1686.43	1685.88	56	GGLINTGDLIEALESGK	biorepCdiff_5
641	1321.67	2641.33	2640.31	29	GLGANVIAFDQYPNSDLNDILTYK	biorepCdiff_7

Matching Genes:

gi|115249400|emb|CAJ67215.1| ((R)-2-hydroxyisocaproate dehydrogenase [Clostridium difficile 630])

Protein Group 70

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
144	3	3	3	6

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
106	513.89	1025.77	1025.59	41	GIGASPGVALGK	biorepCdiff_6
92	594.93	1187.84	1187.60	51	SIDNVEAEIAK	biorepCdiffA_6
216	791.02	1580.03	1579.77	52	TESVNAEYALNEIK	biorepCdiffA_6

Matching Genes:

gi|115251808|emb|CAJ69643.1| (phosphoenolpyruvate-protein phosphotransferase [Clostridium difficile 630])

Protein Group 71

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
142	6	3	2	36

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
801	1332.98	2663.95	2663.20	64	DMNEFGAINEVYAEYFGENKPAR	biorepCdiff_1
764	1116.90	2231.78	2231.13	46	HEVIHTNDAPAALGPYSQAIK	biorepCdiff_1
467	1246.38	2490.75	2490.27	32	MKHEVIHTNDAPAALGPYSQAIK	biorepCdiffA_1

Matching Genes:

gi|115251566|emb|CAJ69399.1| (putative translation inhibitor endoribonuclease [Clostridium difficile 630])

Protein Group 72

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
138	5	3	2	38

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
389	1024.75	2047.49	2046.82	46	DECDNSYIYTFYTNDK	biorepCdiffA_1
676	907.39	1812.76	1812.85	25	EEFEELKNNTYIER	biorepCdiff_1
319	863.58	1725.15	1724.79	67	IVDEYDYGYNAIYK	biorepCdiffA_1

Matching Genes:

gi|115249824|emb|CAJ67641.1| (hypothetical protein [Clostridium difficile 630])

Protein Group 73

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
136	5	3	1	44

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
120	590.43	1178.84	1178.55	37	DLTSEELMNK	biorepCdiffA_1
231	724.99	1447.96	1447.74	67	FQLATGQLENTAR	biorepCdiffA_1
26	426.41	850.80	850.45	32	SELFSLR	biorepCdiffA_1

Matching Genes:

gi|115249085|emb|CAJ66896.1| (50S ribosomal protein L29 [Clostridium difficile 630])

Protein Group 74

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
131	3	2	2	15

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
225	706.97	1411.93	1411.68	65	QNFGQVSNSYIR	biorepCdiffA_3
355	889.08	1776.15	1775.81	66	TGEGDGDDEQIVVDLSK	biorepCdiffA_3

Matching Genes:

gi|115250675|emb|CAJ68499.1| (tellurium resistance protein [Clostridium difficile 630])

Protein Group 75

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
128	5	3	3	17

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
291	775.62	1549.23	1548.81	46	ELSDIIGFTASQIR	biorepCdiffA_3
493	793.13	1584.25	1583.83	42	GVWNFAPLDLEVPK	biorepCdiff_3
151	482.86	963.70	963.50	40	YLGDLLDR	biorepCdiff_3

Matching Genes:

gi|115249180|emb|CAJ66992.1| (putative DNA-binding protein [Clostridium difficile 630])

Protein Group 76

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
126	4	3	2	35

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
228	541.44	1080.87	1080.57	41	EIISYLESK	biorepCdiff_2
771	1159.86	3476.55	3475.61	60	GIECVDYGTNNATDSVDYPVYGEIVANSVINK	biorepCdiff_2
222	702.51	1403.00	1402.67	25	IGLGCDHGGYNLK	biorepCdiffA_2

Matching Genes:

gi|115252540|emb|CAJ70383.1| (ribose-5-phosphate isomerase 2 [Clostridium difficile 630])

Protein Group 77

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
125	4	2	2	21

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
590	738.18	1474.35	1473.79	73	IGVIGGGSITYPNAR	biorepCdiff_1
114	572.40	1142.79	1142.52	52	LSETDEFFR	biorepCdiffA_1

Matching Genes:

gi|115251040|emb|CAJ68871.1| (putative decarboxylase [Clostridium difficile 630])

Protein Group 78

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
124	3	3	1	26

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
809	1179.86	3536.55	3535.76	39	LVMNLGFSHPVEMEDPEGITVEAPNQTELIVK	biorepCdiff_3
85	508.38	1014.74	1014.57	50	QLSAELNIK	biorepCdiffA_3
40	447.38	892.74	892.47	35	YVDEVIR	biorepCdiffA_3

Matching Genes:

gi|115249092|emb|CAJ66903.1| (50S ribosomal protein L6 [Clostridium difficile 630])

Protein Group 79

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
124	3	3	1	5

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
511	1072.96	2143.91	2143.00	35	ADLVTGMVGEFDELQGFMGK	biorepCdiff_7
30	430.95	859.89	859.48	50	FAGDILPK	biorepCdiff_7
117	558.50	1114.98	1114.58	39	LADALFFYR	biorepCdiff_7

Matching Genes:

gi|115251485|emb|CAJ69318.1| (glycyl-tRNA synthetase beta chain [Clostridium difficile 630])

Protein Group 80

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
121	4	2	2	13

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
225	706.97	1411.93	1411.68	65	QNFGQVSNSYIR	biorepCdiffA_3
552	887.74	1773.47	1772.86	56	VEKDEDFIFYNNLK	biorepCdiff_3

Matching Genes:

gi|115250676|emb|CAJ68500.1| (tellurium resistance protein [Clostridium difficile 630])

Protein Group 81

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
121	2	2	1	12

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
84	507.92	1013.82	1013.49	30	FWEEYLK	biorepCdiffA_3
448	739.10	1476.19	1475.76	91	VEAGIYNEILNNK	biorepCdiff_3

Matching Genes:

gi|115252635|emb|CAJ70478.1| (putative preprotein translocase [Clostridium difficile 630])

Protein Group 82

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
118	3	3	1	11

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
375	1069.32	2136.62	2136.05	36	EGVFAGGDAVTGAATVISAMGAGK	biorepCdiffA_6
246	691.53	1381.05	1380.74	53	QAVVQPEIDNIR	biorepCdiff_6
327	989.31	1976.60	1975.92	29	VCPQESQCEGVCILGIK	biorepCdiffA_6

Matching Genes:

gi|115250578|emb|CAJ68402.1| (putative glutamate synthase [NADPH] small chain [Clostridium difficile 630])

Protein Group 83

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
115	3	3	1	4

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
45	497.84	993.67	994.47	34	ENMLWFR	biorepCdiffA_7
621	1195.43	2388.84	2388.17	51	LAPSLTLGCGSWGGNSVSENVGVK	biorepCdiff_6
99	511.54	1021.07	1020.57	30	LSPVLAMYK	biorepCdiff_7

Matching Genes:

gi|115249343|emb|CAJ67156.1| (aldehyde-alcohol dehydrogenase [includes: alcohol dehydrogenase; acetaldehyde dehydrogenase [acetylating]; pyruvate-formate-lyase deactivase [Clostridium difficile 630])

Protein Group 84

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
112	6	3	1	8

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
217	669.43	1336.85	1336.61	52	DTDPQSALEYAK	biorepCdiff_6
501	1037.84	2073.67	2073.00	30	VATYDLKPEMSAYELTDK	biorepCdiff_6
81	583.46	1164.91	1164.60	30	VELAYNAMVR	biorepCdiffA_6

Matching Genes:

gi|115252228|emb|CAJ70068.1| (2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Clostridium difficile 630])

Protein Group 85

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
111	2	2	2	13

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
373	1003.39	2004.77	2003.92	54	DVYACCTHGVLSGPAIER	biorepCdiffA_4
611	796.05	2385.12	2384.26	57	NVILLDDMIDTAGTIVNAANALK	biorepCdiff_4

Matching Genes:

gi|115252575|emb|CAJ70418.1| (ribose-phosphate pyrophosphokinase [Clostridium difficile 630])

Protein Group 86

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
109	3	2	2	10

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
202	687.98	1373.95	1373.76	61	ALQATGLEVTMIK	biorepCdiffA_2
427	696.06	1390.11	1389.75	48	ALQATGLEVTMIK +Oxidation (M)	biorepCdiff_2

Matching Genes:

gi|115249104|emb|CAJ66915.1| (30S ribosomal protein S11 [Clostridium difficile 630])

Protein Group 87

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
107	3	2	1	11

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
426	869.15	1736.28	1735.76	69	ADIDYGFAEADTTYGK	biorepCdiff_4
256	832.62	1663.23	1662.82	38	TEGYSEGNVPLQTLR	biorepCdiffA_4

Matching Genes:

gi|115249083|emb|CAJ66894.1| (30S ribosomal protein S3 [Clostridium difficile 630])

Protein Group 88

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
107	2	2	2	8

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
214	628.04	1254.07	1253.75	46	LPIILYNVPGR	biorepCdiff_4
366	761.21	1520.41	1519.78	61	TAMNILGFNVGDLR	biorepCdiff_4

Matching Genes:

gi|115252280|emb|CAJ70121.1| (dihydrodipicolinate synthase [Clostridium difficile 630])

Protein Group 89

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
107	2	2	2	8

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
214	628.04	1254.07	1253.75	46	LPIILYNVPGR	biorepCdiff_4
366	761.21	1520.41	1519.78	61	TAMNLLGFNVGDLR	biorepCdiff_4

Matching Genes:

gi|115252282|emb|CAJ70123.1| (dihydrodipicolinate synthase [Clostridium difficile 630])

Protein Group 90

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
106	3	3	0	41

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
73	478.40	954.79	954.55	39	KYTFVVAK	biorepCdiffA_1
500	908.01	2721.00	2720.31	31	MTNPHDVIIRPVVTEHSMAEMGEK	biorepCdiffA_1
75	426.01	850.00	849.46	36	VFGVSVDK	biorepCdiff_1

Matching Genes:

gi|115249079|emb|CAJ66890.1| (50S ribosomal protein L23 [Clostridium difficile 630])

Protein Group 91

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
106	3	3	1	5

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
168	620.98	1239.95	1239.65	44	VDAPEILDNVR	biorepCdiff_6
30	460.36	918.70	918.45	30	YALDYFK	biorepCdiffA_6
24	453.36	904.70	904.38	32	YAMDMFK	biorepCdiffA_6

Matching Genes:

gi|115249342|emb|CAJ67155.1| (manganese-dependent inorganic pyrophosphatase [Clostridium difficile 630])

Protein Group 92

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
106	4	2	2	14

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
122	605.98	1209.95	1209.63	59	LSEVVEFYPK	biorepCdiffA_2
175	665.00	1327.98	1327.70	47	NVPVNIWPYAR	biorepCdiffA_2

Matching Genes:

gi|115249997|emb|CAJ67817.1| (hypothetical phage protein [Clostridium difficile 630])

Other Genes Matching Peptide Subset:

gi|115251944|emb|CAJ69780.1| (hypothetical phage protein [Clostridium difficile 630])

Protein Group 93

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
105	2	2	2	4

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
108	518.37	1034.73	1034.55	46	QALSYALNR	biorepCdiff_6
240	846.56	1691.11	1690.74	59	SNSNLQTYTYSEER	biorepCdiffA_6

Matching Genes:

gi|115251723|emb|CAJ69558.1| (oligopeptide ABC transporter, substrate-binding protein [Clostridium difficile 630])

Protein Group 94

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
102	3	2	1	9

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
429	1035.28	2068.55	2067.97	39	GGPGLGSIQPSQADYFMSTR	biorepCdiffA_5
124	632.50	1262.98	1262.65	63	VMTSSSSPGVALK	biorepCdiffA_5

Matching Genes:

gi|115249125|emb|CAJ66936.1| (putative oxidoreductase, thiamine diP-binding subunit [Clostridium difficile 630])

Protein Group 95

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
102	5	1	1	10

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
361	935.32	1868.62	1868.91	102	LAGEGGLFFVDQEFANR	biorepCdiffA_1

Matching Genes:

gi|115251248|emb|CAJ69079.1| (ferritin [Clostridium difficile 630])

Protein Group 96

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
102	4	3	1	6

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
478	1042.75	2083.49	2082.92	40	GTYGDTYGIHGNNNESSIGK	biorepCdiff_7
241	700.53	1399.05	1399.73	33	IAEELGNREEIK	biorepCdiff_7
60	537.38	1072.75	1072.57	29	INLNQTGWK	biorepCdiffA_7

Matching Genes:

gi|115251764|emb|CAJ69599.1| (cell surface protein [Clostridium difficile 630])

Protein Group 97

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
102	3	2	1	32

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
735	1027.39	2052.77	2052.02	38	NYELVYVVKPNSDEEVR	biorepCdiff_1
198	694.02	1386.03	1385.78	64	VKEVVATDGEIVK	biorepCdiffA_1

Matching Genes:

gi|115252728|emb|CAJ70572.1| (30S ribosomal protein S6 [Clostridium difficile 630])

Protein Group 98

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
98	3	3	0	11

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
105	535.50	1068.99	1068.59	26	FTAEVYVLK	biorepCdiff_5
353	590.32	1767.94	1767.78	34	HYAHVDCPGHADYVK	biorepCdiffA_3
468	1083.35	2164.68	2164.04	38	YQLGEAVDFANIDKAPEER	biorepCdiffA_5

Matching Genes:

gi|115249061|emb|CAJ66872.1| (elongation factor TU [Clostridium difficile 630])

Other Genes Matching Peptide Subset:

gi|115249075|emb|CAJ66886.1| (elongation factor TU [Clostridium difficile 630])

Protein Group 99

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
98	2	2	1	25

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
510	1031.34	3091.01	3091.55	62	KGEFFCSEAVLQTINDALGQPLSPEITK	biorepCdiffA_2
98	530.46	1058.91	1058.61	36	LASGFPIGLGK	biorepCdiffA_2

Matching Genes:

gi|115252075|emb|CAJ69912.1| (conserved hypothetical protein [Clostridium difficile 630])

Protein Group 100

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
97	3	2	2	5

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
43	465.38	928.74	928.56	44	IGIEGSILK	biorepCdiffA_5
199	646.11	1290.21	1289.70	53	ILVLNCGSSSLK	biorepCdiff_5

Matching Genes:

gi|115250207|emb|CAJ68028.1| (acetate kinase [Clostridium difficile 630])

Protein Group 101

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
97	4	2	2	19

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
242	566.42	1130.83	1130.67	50	IQVFEGVVLK	biorepCdiff_2
402	687.44	1372.86	1372.66	47	NEVPNFGPGDTVK	biorepCdiff_2

Matching Genes:

gi|115250291|emb|CAJ68113.1| (50S ribosomal protein L19 [Clostridium difficile 630])

Protein Group 102

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
97	3	3	0	5

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
127	572.97	1143.93	1143.57	32	APESLIEEEK	biorepCdiff_7
198	668.58	1335.15	1334.70	33	TYLQWLENIR	biorepCdiff_7
491	1338.56	2675.11	2675.09	32	YNEEDNMAEEEDMMNLLMEGIR	biorepCdiffA_7

Matching Genes:

gi|115252312|emb|CAJ70153.1| (valyl-tRNA synthetase [Clostridium difficile 630])

Protein Group 103

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
94	6	2	1	19

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
215	518.44	1034.86	1034.54	34	GITEVVFDR	biorepCdiff_2
570	574.82	1721.42	1720.87	60	SANNIYAQIIDDTKR	biorepCdiff_2

Matching Genes:

gi|115249093|emb|CAJ66904.1| (50S ribosomal protein L18 [Clostridium difficile 630])

Protein Group 104

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
94	3	1	1	25

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
351	919.23	1836.44	1835.88	94	TLEEGQSVEFEVVDGAK	biorepCdiffA_1

Matching Genes:

gi|115250391|emb|CAJ68213.1| (putative cold shock protein [Clostridium difficile 630])

Protein Group 105

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
93	3	2	1	22

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
139	651.97	1301.93	1301.68	32	EVEASVGGGAVTVK	biorepCdiff_8
186	675.39	1348.77	1348.63	61	NIDDIQASQMSK	biorepCdiffA_1

Matching Genes:

gi|115249020|emb|CAJ66831.1| (conserved hypothetical protein [Clostridium difficile 630])

Protein Group 106

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
92	5	2	1	16

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
114	583.48	1164.94	1164.60	34	EQALVEVSYK	biorepCdiffA_2
480	730.57	1459.12	1458.78	58	ILGGGLPYESAVQR	biorepCdiff_2

Matching Genes:

gi|115249807|emb|CAJ67624.1| (putative NUDIX-family hydrolase [Clostridium difficile 630])

Protein Group 107

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
88	2	2	1	5

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
227	676.56	1351.11	1350.79	54	IVEVPVGEALIGR	biorepCdiff_6
205	770.52	1539.02	1538.81	34	TRPVESEAPGIIDR	biorepCdiffA_6

Matching Genes:

gi|115252530|emb|CAJ70373.1| (ATP synthase alpha chain [Clostridium difficile 630])

Protein Group 108

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
87	3	2	2	7

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
50	522.93	1043.85	1043.55	43	ALEAAEELAK	biorepCdiffA_4
231	638.52	1275.02	1274.65	44	HYGLTTEDIVK	biorepCdiff_4

Matching Genes:

gi|115251376|emb|CAJ69208.1| (transketolase [Clostridium difficile 630])

Protein Group 109

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
87	2	2	1	13

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
66	484.89	967.76	967.57	39	ILLDEPIR	biorepCdiffA_3
220	566.65	1131.29	1131.60	48	MAVQADSVAIK	biorepCdiff_3

Matching Genes:

gi|115252722|emb|CAJ70566.1| (50S ribosomal protein L9 [Clostridium difficile 630])

Protein Group 110

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
82	3	2	1	26

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
322	584.39	1750.16	1749.89	35	HQKPSAMNQQGGIINK	biorepCdiffA_1
119	586.00	1169.98	1169.70	47	VLVEGVNVITK	biorepCdiffA_1

Matching Genes:

gi|115249088|emb|CAJ66899.1| (50S ribosomal protein L24 [Clostridium difficile 630])

Protein Group 111

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
81	2	2	2	4

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
335	807.63	1613.24	1612.76	40	FFNEEEMNAILTR	biorepCdiff_6
142	593.72	1185.42	1184.64	41	VGQEGVTSPIAK	biorepCdiff_6

Matching Genes:

gi|115251791|emb|CAJ69626.1| (putative aspartyl-tRNA synthetase [Clostridium difficile 630])

Protein Group 112

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
81	2	2	1	4

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
111	621.48	1240.95	1240.61	28	AFDYVTQEIR	biorepCdiffA_6
314	809.11	1616.21	1615.81	53	IVLEENEQSLPMSK	biorepCdiffA_3

Matching Genes:

gi|115252300|emb|CAJ70141.1| (proline reductase subunit proprotein [Clostridium difficile 630])

Protein Group 113

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
79	2	2	1	6

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
59	501.97	1001.93	1001.55	51	FVIEPLER	biorepCdiffA_5
167	669.64	1337.27	1336.65	28	VDIVELSEDYR	biorepCdiffA_5

Matching Genes:

gi|115249106|emb|CAJ66917.1| (DNA-directed RNA polymerase alpha chain [Clostridium difficile 630])

Protein Group 114

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
78	3	2	1	16

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
53	460.47	918.92	918.52	40	FEILEIR	biorepCdiffA_3
456	696.24	2085.69	2084.99	38	VAISFGDLSENAEYDEAKK	biorepCdiffA_3

Matching Genes:

gi|115252616|emb|CAJ70459.1| (transcription elongation factor [Clostridium difficile 630])

Protein Group 115

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
77	2	2	1	4

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
90	592.94	1183.86	1183.61	29	LDIYQEYIK	biorepCdiffA_6
159	687.55	1373.08	1372.72	48	NLSKEEVEANIK	biorepCdiffA_6

Matching Genes:

gi|115249054|emb|CAJ66865.1| (glutamyl-tRNA synthetase [Clostridium difficile 630])

Protein Group 116

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
76	2	1	1	3

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
379	869.60	1737.19	1736.85	76	SIVVEGESDSSYPLQK	biorepCdiff_6

Matching Genes:

gi|115251299|emb|CAJ69130.1| (asparaginyl-tRNA synthetase [Clostridium difficile 630])

Protein Group 117

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
76	2	1	1	3

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
248	694.43	1386.84	1386.70	76	KLEEGADVDLGNK	biorepCdiff_6

Matching Genes:

gi|115251396|emb|CAJ69228.1| (gamma-aminobutyrate metabolism dehydratase/isomerase [includes: 4-hydroxybutyryl-coa dehydratase; vinylacetyl-coa-delta-isomerase] [Clostridium difficile 630])

Protein Group 118

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
76	4	2	1	13

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
348	864.64	1727.26	1726.88	50	EGITSVGENKPQELAR	biorepCdiffA_3
590	934.30	1866.58	1865.85	26	GLMTMAPFIEDEDEIR	biorepCdiff_3

Matching Genes:

gi|115251674|emb|CAJ69509.1| (putative alanine racemase [Clostridium difficile 630])

Protein Group 119

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
73	3	2	1	29

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
347	914.46	1826.90	1826.94	41	AEGDTGSPEVQIALLTAR	biorepCdiffA_1
17	417.93	833.84	833.50	32	NLLAYLK	biorepCdiffA_1

Matching Genes:

gi|115250352|emb|CAJ68174.1| (30S ribosomal protein S15 [Clostridium difficile 630])

Protein Group 120

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
70	2	1	1	9

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
351	881.72	1761.43	1760.81	70	TGVGDGDDEQINVDLSK	biorepCdiffA_3

Matching Genes:

gi|115250845|emb|CAJ68669.1| (tellurium resistance protein [Clostridium difficile 630])

Protein Group 121

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
70	2	1	1	5

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
329	696.69	1391.37	1390.68	70	MEEEGVFNVLPK	biorepCdiff_4

Matching Genes:

gi|115251194|emb|CAJ69025.1| (30S ribosomal protein S2 [Clostridium difficile 630])

Protein Group 122

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
69	3	2	1	7

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
161	661.49	1320.97	1320.66	29	AVQLHGGYGYTR	biorepCdiffA_5
355	763.10	1524.18	1523.75	40	ITEIYEGTSEVQR	biorepCdiff_5

Matching Genes:

gi|115250075|emb|CAJ67895.1| (butyryl-CoA dehydrogenase [Clostridium difficile 630])

Protein Group 123

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
68	1	1	1	18

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
630	688.96	2063.86	2063.24	68	IATAGVVLGAVTGAVSGVLLAPK	biorepCdiff_2

Matching Genes:

gi|115250942|emb|CAJ68770.1| (putative membrane protein [Clostridium difficile 630])

Protein Group 124

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
68	1	1	1	6

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
422	712.53	1423.05	1422.62	68	TTGICIDCSSPGR	biorepCdiff_3

Matching Genes:

gi|115251115|emb|CAJ68946.1| (conserved hypothetical protein [Clostridium difficile 630])

Protein Group 125

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
68	2	1	1	2

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
303	772.00	1541.99	1541.66	68	YVDSNNENEPFSK	biorepCdiff_7

Matching Genes:

gi|115251575|emb|CAJ69408.1| (leucyl-tRNA synthetase [Clostridium difficile 630])

Protein Group 126

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
66	2	2	0	5

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
212	534.76	1601.26	1600.80	30	DLEEYLHLLEEAK	biorepCdiffA_7
544	1125.33	2248.64	2248.13	36	ELGLFMIPEEGPGFPMFLPK	biorepCdiff_7

Matching Genes:

gi|115249589|emb|CAJ67406.1| (threonyl-tRNA synthetase [Clostridium difficile 630])

Protein Group 127

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
65	2	2	0	15

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
288	813.19	1624.36	1623.81	31	HVPVYITEDMVGHK	biorepCdiffA_1
291	821.10	1640.19	1639.80	34	HVPVYITEDMVGHK +Oxidation (M)	biorepCdiffA_1

Matching Genes:

gi|115249081|emb|CAJ66892.1| (30S ribosomal protein S19 [Clostridium difficile 630])

Protein Group 128

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
64	2	2	0	15

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
243	736.62	1471.23	1470.80	38	IYSSLYLEDLKK	biorepCdiffA_2
159	648.45	1294.89	1294.63	26	YLIDITEEGDK	biorepCdiffA_2

Matching Genes:

gi|115250371|emb|CAJ68193.1| (MarR-family transcriptional regulator [Clostridium difficile 630])

Protein Group 129

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
63	2	2	0	3

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
407	625.84	1874.51	1873.98	29	DGSLVGAILINDLSCTVK	biorepCdiff_7
140	607.46	1212.90	1212.65	34	VNLFDVIEHK	biorepCdiff_7

Matching Genes:

gi|115250664|emb|CAJ68488.1| (putative nitric oxide reductase flavoprotein [Clostridium difficile 630])

Protein Group 130

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
63	1	1	1	2

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
183	749.05	1496.09	1495.69	63	VYGEGADSQGVSATR	biorepCdiffA_7

Matching Genes:

gi|115251074|emb|CAJ68905.1| (chaperone [Clostridium difficile 630])

Protein Group 131

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
63	1	1	1	9

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
230	715.99	1429.96	1429.74	63	VTVDENTIGQINK	biorepCdiffA_2

Matching Genes:

gi|115251795|emb|CAJ69630.1| (putative D-tyrosyl-tRNA protein [Clostridium difficile 630])

Protein Group 132

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
62	4	2	0	18

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
538	697.60	1393.20	1392.70	31	KGDAAEMAFIELV	biorepCdiff_1
275	494.94	987.87	987.55	31	NLVTCLLR	biorepCdiff_1

Matching Genes:

gi|115249107|emb|CAJ66918.1| (50S ribosomal protein L17 [Clostridium difficile 630])

Protein Group 133

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
62	1	1	1	15

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
304	838.83	1675.64	1675.83	62	VETQGATGIDNELTTK	biorepCdiffA_1

Matching Genes:

gi|115252071|emb|CAJ69908.1| (PTS system, IIb component [Clostridium difficile 630])

Protein Group 134

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
61	1	1	1	12

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
318	861.73	1721.45	1720.82	61	GYDVSSISTPDLENPK	biorepCdiffA_1

Matching Genes:

gi|115249013|emb|CAJ66824.1| (anti-sigma-B factor (serine-protein kinase) [Clostridium difficile 630])

Protein Group 135

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
60	1	1	1	6

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
689	1029.57	3085.68	3085.44	60	EFYPDASEFYLSDGYDLVNALTGSTIAK	biorepCdiff_4

Matching Genes:

gi|115251246|emb|CAJ69077.1| (cell surface protein [Clostridium difficile 630])

Protein Group 136

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
60	1	1	1	13

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
753	881.73	2642.16	2641.24	60	LPGEVESYEYGLEYGTDTLEIHK	biorepCdiff_3

Matching Genes:

gi|115251797|emb|CAJ69632.1| (adenine phosphoribosyltransferase [Clostridium difficile 630])

Protein Group 137

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
58	1	1	1	4

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
611	1182.90	2363.78	2364.29	58	EILGDIPISLSNEIGNIGILER	biorepCdiff_6

Matching Genes:

gi|115250762|emb|CAJ68586.1| (putative hydantoinase [Clostridium difficile 630])

Protein Group 138

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
58	2	1	1	3

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
195	644.44	1286.87	1286.63	58	ADAYGHGAVEVAK	biorepCdiff_5

Matching Genes:

gi|115252523|emb|CAJ70366.1| (alanine racemase [Clostridium difficile 630])

Protein Group 139

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
57	2	1	1	16

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
671	900.41	1798.80	1797.88	57	FIEEIGYYNPISEPK	biorepCdiff_1

Matching Genes:

gi|115250287|emb|CAJ68109.1| (30S ribosomal protein S16 [Clostridium difficile 630])

Protein Group 140

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
56	1	1	1	13

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
145	631.68	1261.34	1260.71	56	TIVVAVEEFVR	biorepCdiffA_1

Matching Genes:

gi|115249086|emb|CAJ66897.1| (30S ribosomal protein S17 [Clostridium difficile 630])

Protein Group 141

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
56	1	1	1	0

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
256	773.51	1545.01	1544.67	56	NIAYNYTDESNNK	biorepCdiff_8

Matching Genes:

gi|115249677|emb|CAJ67494.1| (toxin A [Clostridium difficile 630])

Protein Group 142

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
56	1	1	1	6

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
400	815.78	1629.55	1628.88	56	FGDGGVDILPIANLTK	biorepCdiff_4

Matching Genes:

gi|115249811|emb|CAJ67628.1| (NH3-dependent NAD(+) synthetase [Clostridium difficile 630])

Protein Group 143

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
56	1	1	1	6

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
176	683.55	1365.09	1364.70	56	IEELQFNPFTK	biorepCdiffA_4

Matching Genes:

gi|115251448|emb|CAJ69281.1| (conserved hypothetical protein [Clostridium difficile 630])

Protein Group 144

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
55	1	1	1	8

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
339	663.01	1324.00	1323.64	55	VMFELAGVSEDK	biorepCdiff_3

Matching Genes:

gi|115249084|emb|CAJ66895.1| (50S ribosomal protein L16 [Clostridium difficile 630])

Protein Group 145

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
54	2	2	0	6

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
153	454.04	1359.10	1358.68	29	AFEGTLLAHTDGK	biorepCdiffA_6
378	816.74	1631.46	1630.87	25	TGLGNTFLGWIDLPK	biorepCdiff_5

Matching Genes:

gi|115252341|emb|CAJ70182.1| (glucose-6-phosphate isomerase [Clostridium difficile 630])

Protein Group 146

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
54	1	1	1	22

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
147	636.60	1271.18	1270.70	54	LIDEALEDLIK	biorepCdiffA_1

Matching Genes:

gi|110666931|ref|YP_659585.1| (hypothetical protein CDP09 [Clostridium difficile 630])

Protein Group 147

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
53	1	1	1	4

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
435	763.28	2286.82	2286.04	53	NSLTNKPTWSPMGSSANHEGR +Oxidation (M)	biorepCdiffA_6

Matching Genes:

gi|115250843|emb|CAJ68667.1| (putative pyridine nucleotide-disulfide oxidoreductase [Clostridium difficile 630])

Protein Group 148

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
51	2	1	1	2

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
57	453.03	904.04	903.51	51	YDLVPGLK	biorepCdiff_5

Matching Genes:

gi|115249115|emb|CAJ66926.1| (aspartate aminotransferase [Clostridium difficile 630])

Protein Group 149

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
48	1	1	1	6

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
522	844.23	1686.44	1685.83	48	VNVYYDNPLEVAYK	biorepCdiff_3

Matching Genes:

gi|115250593|emb|CAJ68417.1| (putative 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylidene amino] imidazole-4-carboxamide isomerase [Clostridium difficile 630])

Protein Group 150

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
48	1	1	1	10

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
419	635.57	1269.13	1268.60	48	IGIDEDHSVER	biorepCdiff_1

Matching Genes:

gi|115252725|emb|CAJ70569.1| (conserved hypothetical protein [Clostridium difficile 630])

Protein Group 151

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
47	2	1	1	6

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
39	497.77	993.53	993.55	47	YPFLLVDK	biorepCdiffA_8

Matching Genes:

gi|115249137|emb|CAJ66948.1| ((3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase [Clostridium difficile 630])

Protein Group 152

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
47	2	1	1	2

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
330	800.57	1599.13	1598.76	47	TYVSAYHSTNLSEK	biorepCdiff_6

Matching Genes:

gi|115251837|emb|CAJ69672.1| (cell surface protein [Clostridium difficile 630])

Protein Group 153

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
46	2	1	1	5

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
76	493.90	985.79	985.62	46	IIVNSSLIK	biorepCdiffA_3

Matching Genes:

gi|115249127|emb|CAJ66938.1| (putative subunit of oxidoreductase [Clostridium difficile 630])

Protein Group 154

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
45	1	1	1	7

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
107	552.04	1102.06	1101.57	45	IPTWIDTEK	biorepCdiffA_1

Matching Genes:

gi|115250980|emb|CAJ68809.1| (conserved hypothetical protein [Clostridium difficile 630])

Protein Group 155

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
45	1	1	1	23

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
784	784.73	2351.17	2350.11	45	EAEAALNAFMSSVQDALVNNEK	biorepCdiff_1

Matching Genes:

gi|115252557|emb|CAJ70400.1| (DNA-binding protein HU [Clostridium difficile 630])

Protein Group 156

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
44	2	1	1	7

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
460	748.10	1494.18	1493.85	44	AGVVLNPATPVDTIK	biorepCdiff_3

Matching Genes:

gi|115251631|emb|CAJ69464.1| (ribulose-phosphate 3-epimerase [Clostridium difficile 630])

Protein Group 157

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
43	2	1	1	4

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
350	726.24	1450.46	1449.75	43	GFFPEEELITLR	biorepCdiff_4

Matching Genes:

gi|115251377|emb|CAJ69209.1| (transketolase [Clostridium difficile 630])

Protein Group 158

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
42	2	1	1	3

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
160	689.97	1377.93	1377.68	42	EDLFNSLEVGQK	biorepCdiffA_6

Matching Genes:

gi|115250007|emb|CAJ67827.1| (putative 30S ribosomal protein S1 [Clostridium difficile 630])

Protein Group 159

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
41	1	1	1	19

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
179	670.49	1338.97	1338.70	41	VSHLLEVTEIAE	biorepCdiffA_1

Matching Genes:

gi|115249095|emb|CAJ66906.1| (50S ribosomal protein L30 [Clostridium difficile 630])

Protein Group 160

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
41	1	1	1	4

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
215	628.58	1255.14	1254.72	41	IANAILVGDIEK	biorepCdiff_4

Matching Genes:

gi|115249121|emb|CAJ66932.1| (phosphate butyryltransferase [Clostridium difficile 630])

Protein Group 161

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
41	4	1	1	17

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
453	1147.87	2293.74	2293.12	41	LADVAELDTLLSDKEYEAGLE	biorepCdiffA_2

Matching Genes:

gi|115249746|emb|CAJ67563.1| (putative glycine cleavage system H protein [Clostridium difficile 630])

Protein Group 162

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
41	1	1	1	3

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
319	736.59	1471.17	1470.69	41	ENMQNHVETLTR	biorepCdiff_5

Matching Genes:

gi|115250313|emb|CAJ68135.1| (cysteine desulfurase [Clostridium difficile 630])

Protein Group 163

Expression Quality:

Score	Num Spectra	Num Peptides	High-Qual Peptides	% Coverage
41	1	1	1	4

Peptides:

Query	Observed	Mr(expt)	Mr(calc)	Score	Peptide	Result File
259	693.17	1384.32	1383.80	41	ILITGSPIGGISEK	biorepCdiff_5

Matching Genes:

gi|115250793|emb|CAJ68617.1| (putative 2-hydroxyacyl-CoA dehydratase [Clostridium difficile 630])